KEGG   Bacillus subtilis subsp. subtilis 168: BSU10150
Entry
BSU10150          CDS       T00010                                 

Symbol
yhgD
Name
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N TetR_C_24 TetR_C_7 RICH TetR_C_9
Other DBs
NCBI-GeneID: 939305
NCBI-ProteinID: NP_388896
Pasteur: BG10432
BSORF: BG10432
UniProt: P32398 A0A6M3Z934
Position
1089755..1090330
AA seq 191 aa
MSIDRKKLILEAATKSFTQFGYKATTMDLVAKLANVGKGTIYTFFKNKEELFDEIFTTLL
KEMKQKADEAMEPSLPFHENVHRALFAILEFRKTHQLTIKIFQENAEIGTMAVQEVIQKM
ERSILSYIKSKIEDGIKSGAIKPCDPELTAFVMLKLYIALIFDWEKQHPPLDKETIAGLL
ELYVVKGLSAN
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtcaatagatcgaaaaaagctcattttggaggcggctacaaagtctttcacgcagttc
gggtataaagcgacgacaatggatcttgtcgcaaaacttgcgaacgtggggaagggaacc
atttatacttttttcaaaaacaaagaagagctgtttgacgagattttcactactttatta
aaggaaatgaagcaaaaagcggatgaagcgatggagccgagccttccgttccatgaaaat
gtgcacagagcgctgtttgccattctggagttcaggaaaacacatcagctgacgattaaa
attttccaagagaatgccgagattggtacaatggcagttcaggaagtgatccagaaaatg
gagcgatccatcctgtcttatatcaaaagcaagattgaagacgggatcaaaagcggcgca
atcaagccgtgcgaccctgagctgacagcctttgtgatgctgaagctttatatcgcgctc
atttttgactgggaaaaacaacaccccccgcttgataaagagacaattgcgggactgctt
gaattgtatgttgtcaaaggattgtcagcgaactag

DBGET integrated database retrieval system