KEGG   Bacillus subtilis subsp. subtilis 168: BSU10160
Entry
BSU10160          CDS       T00010                                 

Gene name
yhgE
Definition
(RefSeq) hypothetical protein
  KO
K01421  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU10160 (yhgE)
SSDB
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane Crescentin Laminin_II Prominin DUF489 DASH_Dad2 DUF2203 SSFA2_C DUF3450 Vps5 TFR_dimer KASH_CCD CENP-F_leu_zip
Other DBs
NCBI-GeneID: 936303
NCBI-ProteinID: NP_388897
Pasteur: BG10433
BSORF: BG10433
UniProt: P32399
Position
1090401..1092728
AA seq 775 aa
MNTIRSQWKDIVTSKKLLIPIIAILFVPLIYSGVFLKAYWDPYGTVDQLPVVVVNQDKGA
TYEGEKLQIGDDLVKELKDNNNFDWHFSNDLDQSLKDLLNQKYYLVVEIPEDFSKNASTV
LDKNPKKLDLKYHTNAGSNYVGATIGEKAIDKLKASVSKEVTEQYTKVIFDNFKDIAKGL
SDASSGAKKIDDGTKDAKNGSAQLKENLAKLKESTATISDKTAQLADGAAQVTSGIQSLD
SSLGKFQDSSNQIYDKSSQLAAGSGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQ
EGSEKAAKAEKIINALDLTKLETAVNNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVI
NSSDFLTAEQKSQLINSVEKKLPQVDAPDFDQILSQLPTADQLPDIATIKSSLEDVKAQV
AQVKAMPEATSKLYNGAKTIQDAIDRLTEGADKIYNGSQKLTDGQTKLTAGIGEYNKQFA
KAKAGSEQLVTGSSQVSGGLFKLLDGSKQVQSGSSKLADGSASLDTGLGKLLDGTGELSS
KLKDAADQTGDIDADDQTYGMFADPVKTKDDAIHSVPNYGTGLTPYILSMGLYVGGIMLT
VVFPLKEASGRPRNGFEWFFSKFNVMMLVGIIQSLIVATVLLLGIGLEVESTWRFYVFTI
ITSLAFLAIIQFLATTMGNPGRFIAVIILVLQLGASGGTFPLELLPNFYQVIHGALPMTY
SINGFRAVISNGDFGYMWQMAGVLIGIALVMIALSITYFTMLSRKEETSEEQPAS
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgaacacaatacgaagtcagtggaaagacatcgtaacaagtaaaaaattattgattccc
atcatcgccattttgtttgtcccgcttatttacagcggcgtattcttaaaggcttattgg
gacccgtacggcacagttgaccagctgcctgtcgttgtcgtcaaccaagacaagggagca
acgtatgaaggagaaaaacttcaaatcggtgatgatctggtcaaagaattaaaggataat
aacaactttgattggcatttttccaatgatctcgaccaatcgttaaaggacttattgaat
caaaaatattatttagttgtcgagattcctgaggatttttctaagaatgccagcactgta
ttagacaaaaatccgaaaaaattggatctgaaataccatacaaatgcaggttctaactat
gtaggggcaacgatcggcgaaaaagcgattgataaactgaaagcctctgtttcaaaagaa
gtgaccgagcaatatacgaaagttatttttgataactttaaagatatcgcaaaaggtttg
agcgacgcgagcagcggcgcgaaaaaaattgatgacggcacaaaggatgcgaaaaacgga
agcgcccagctgaaagaaaatctggcgaagctgaaggaaagcaccgctaccatcagtgac
aaaacagcgcagcttgcagatggagcggctcaggtgacgagcggcatccaatcacttgac
agctcgctcggtaaattccaggacagcagcaaccagatttatgataaatctagtcagctt
gcagcaggatcaggcgagctgacaagcaagatgaatgaacttcttgccggacttcaaaat
gtgcagaagggtacgcctaatcttactaacgggttggatcagctcaacagtaaagtccaa
gaaggttctgagaaagcggcaaaagcggaaaagatcattaatgcgctcgatttaacgaag
cttgaaactgctgtaaacaatctggaaaagtcagaaactgcgatgaaggaattcaaaaaa
cagctgactgactttgaaaacagtttgaaaaaccgtgatcaggcatttaaaaatgtcatc
aattcgagtgacttcttaacagcggagcaaaaaagccagctgattaattctgttgagaaa
aagcttccgcaagttgatgcgcctgattttgatcaaatattaagccagctacctacagct
gatcagctgcctgacatcgcaacgataaaaagctctcttgaagacgtgaaagcgcaggtg
gcgcaggtgaaagccatgccggaagctacatctaagctttataacggcgcaaaaacaatc
caagatgcgattgacagattaactgagggagctgataagatatacaacggttctcagaag
ctgacagatggccaaactaaactgacagcgggcatcggtgaatataataagcagttcgca
aaagcaaaagcgggctcagagcaattggtgacaggaagcagccaagtatccggcggattg
tttaagctgttagacgggtctaaacaggtccaaagcggatcatcaaaacttgcagacgga
tctgcatcacttgatacaggtttaggcaagctattggacggcacaggagagctgtctagt
aagctgaaggatgcggctgaccaaacaggagatatcgatgctgatgatcaaacatacggc
atgtttgcggatccggttaaaaccaaagatgatgccattcattccgttcctaactatgga
acagggctgacaccttatatcctgtcaatgggcttgtatgtcggcggcatcatgctgacg
gttgtcttcccgctgaaggaagcgtcaggacgtccgagaaacggttttgagtggttcttc
agcaaattcaatgtcatgatgcttgtaggaatcattcaatcattgattgtggcgacggtt
cttctattgggaattggtcttgaggtagagagcacgtggagattttacgtgtttacgatc
attacgagtctcgctttcctggcgataattcaatttttggctacaacgatgggcaacccg
gggcgatttatcgcagtcattattttagtgctgcagctgggagcgagcggaggaaccttc
ccgctggaattgcttccgaatttctatcaggtcatccacggcgcattgccgatgacctac
agcattaacggattcagagcagtcatttcaaacggtgactttggctacatgtggcagatg
gccggcgtcttaatcggcattgccctcgtcatgattgcactaagcattacttactttaca
atgttaagccggaaggaagaaacatcagaagaacagccggcttcataa

DBGET integrated database retrieval system