KEGG   Bacillus subtilis subsp. subtilis 168: BSU10170
Entry
BSU10170          CDS       T00010                                 

Gene name
fabHB
Definition
(RefSeq) 3-oxoacyl-ACP synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu01100  Metabolic pathways
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU10170 (fabHB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU10170 (fabHB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     BSU10170 (fabHB)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU10170 (fabHB)
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Chal_sti_synt_C Thiolase_N HMG_CoA_synt_N
Other DBs
NCBI-GeneID: 939306
NCBI-ProteinID: NP_388898
Pasteur: BG13048
BSORF: BG13048
UniProt: O07600 A0A6M3ZCI3
Position
complement(1092770..1093747)
AA seq 325 aa
MSKAKITAIGTYAPSRRLTNADLEKIVDTSDEWIVQRTGMRERRIADEHQFTSDLCIEAV
KNLKSRYKGTLDDVDMILVATTTSDYAFPSTACRVQEYFGWESTGALDINATCAGLTYGL
HLANGLITSGLHQKILVIAGETLSKVTDYTDRTTCVLFGDAAGALLVERDEETPGFLASV
QGTSGNGGDILYRAGLRNEINGVQLVGSGKMVQNGREVYKWAARTVPGEFERLLHKAGLS
SDDLDWFVPHSANLRMIESICEKTPFPIEKTLTSVEHYGNTSSVSIVLALDLAVKAGKLK
KDQIVLLFGFGGGLTYTGLLIKWGM
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtcaaaagcaaaaattacagctatcggcacctatgcgccgagcagacgtttaaccaat
gcagatttagaaaagatcgttgatacctctgatgaatggatcgttcagcgcacaggaatg
agagaacgccggattgcggatgaacatcaatttacctctgatttatgcatagaagcggtg
aagaatctcaagagccgttataaaggaacgcttgatgatgtcgatatgatcctcgttgcc
acaaccacatccgattacgcctttccgagtacggcatgccgcgtacaggaatatttcggc
tgggaaagcaccggcgcgctggatattaatgcgacatgcgccgggctgacatacggcctc
catttggcaaatggattgatcacatctggccttcatcaaaaaattctcgtcatcgccgga
gagacgttatcaaaggtaaccgattataccgatcgaacgacatgcgtactgttcggcgat
gccgcgggtgcgctgttagtagaacgagatgaagagacgccgggatttcttgcgtctgta
caaggaacaagcgggaacggcggcgatattttgtatcgtgccggactgcgaaatgaaata
aacggtgtgcagcttgtcggttccggaaaaatggtgcaaaacggacgcgaggtatataaa
tgggccgcaagaaccgtccctggcgaatttgaacggcttttacataaagcaggactcagc
tccgatgatctcgattggtttgttcctcacagcgccaacttgcgcatgatcgagtcaatt
tgtgaaaaaacaccgttcccgattgaaaaaacgctcactagtgttgagcactacggaaac
acgtcttcggtttcaattgttttggcgctcgatctcgcagtgaaagccgggaagctgaaa
aaagatcaaatcgttttgcttttcgggtttggcggcggattaacctatacaggattgctt
attaaatgggggatgtaa

DBGET integrated database retrieval system