KEGG   Bacillus subtilis subsp. subtilis 168: BSU10180
Entry
BSU10180          CDS       T00010                                 

Symbol
yhfC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YhfC Rce1-like
Other DBs
NCBI-GeneID: 936308
NCBI-ProteinID: NP_388899
Pasteur: BG13049
BSORF: BG13049
UniProt: O07601 A0A6M4JLQ6
Position
1093874..1094650
AA seq 258 aa
MVSQEAVVFLALSGAIAFLLPIGLIVWFKRKYGASLKVFFIGALTFFVFAQLLEGGVHVY
VLQVNEMTKEAMQHPLWYGIYGCLMAGIFEECGRYLMMRFFMKRHHTWADGLAFGAGHGG
LEAILITGLSSISLIVYAFAINSGTFEQLLVNGDVKQALLPIQEQLLHTPSYEWMLGGIE
RISAIAVQIGLSLLVLYAVKNRRPLFLLYSILLHALFNVPAVLYQRGIIEHAAAVEIIVA
LIAALSVYWIVKAKRVFQ
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcagtcaagaagcagtagtctttttggcattatccggggctattgcgtttctgttg
ccaatcgggctgattgtatggtttaagcgaaagtatggtgcctcgcttaaagtgtttttt
attggcgctctcacgttttttgtcttcgctcagctgctggaaggcggcgttcatgtttat
gtactgcaagtgaatgaaatgacgaaagaagcgatgcagcatccattatggtatggcatt
tacggctgcttgatggccggcatttttgaggagtgcggaaggtatttgatgatgcgattt
tttatgaagcgccatcatacttgggcagatggtctggctttcggggcaggccatggcggg
cttgaagccatcctgattacaggcttgtcctctatctcacttattgtatacgcatttgca
atcaatagcgggacgtttgaacagcttttggtcaatggcgacgtcaaacaggcgcttttg
ccgatacaggagcagctgctgcatactccttcgtatgaatggatgctgggcggaatagaa
agaatcagtgccattgccgtccagattggtctgtctctgcttgttttgtacgcggttaaa
aaccgccggccgctgtttttgctgtattctattcttttacatgcactgtttaatgtcccg
gcggttttatatcaaagaggaatcatagagcatgctgcagctgttgaaatcattgttgct
cttatagcggctttatcagtttattggattgtaaaagcaaaaagggtgtttcaataa

DBGET integrated database retrieval system