KEGG   Bacillus subtilis subsp. subtilis 168: BSU10200
Entry
BSU10200          CDS       T00010                                 

Symbol
yhfE
Name
(RefSeq) aminopeptidase YhfE
  KO
K01269  aminopeptidase [EC:3.4.11.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU10200 (yhfE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     BSU10200 (yhfE)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M42: glutamyl aminopeptidase family
   BSU10200 (yhfE)
SSDB
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 DUF3247 N_Asn_amidohyd
Other DBs
NCBI-GeneID: 936306
NCBI-ProteinID: NP_388901
Pasteur: BG13051
BSORF: BG13051
UniProt: O07603 A0A6M3Z9M5
Position
1095063..1096103
AA seq 346 aa
MTSVRKTMELIKELVSIPSPTGNTYEVINYIESLLKEWKVETVRNHKGGLIATLPGRDTS
RHRMLTAHVDTLGAMVKEIKADGRLKIDLIGGFRYNSIEGEYCQIETASGKMYTGTILMH
QTSVHVYKDAGKAERNQENMEIRLDEPVHCRKDTEELGIGVGDFVSFDPRVEITSSGFIK
SRHLDDKASVALLLRLIHEIQTEDIELPYTTHFLISNNEEIGYGGNSNIPPETVEYLAVD
MGAIGDGQATDEYSVSICVKDASGPYHYQLRKHLVQLAEKHHIDYKLDIYPYYGSDASAA
IKSGHDIVHGLIGPGIDASHAFERTHKSSLRHTAKLLYYYVQSPMV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgacgtccgtacgtaaaacgatggagctcattaaagaacttgtatcgatcccaagcccg
acaggaaatacatatgaggtgatcaattatattgaaagccttttaaaagaatggaaggta
gaaacggttcggaaccacaagggcggcttaattgcaacgcttccaggacgcgacacatcc
cggcatcgcatgctgacagcgcacgttgacaccctcggcgctatggtgaaggaaattaaa
gcggacggccggctgaaaatcgacttaatcggcgggttccgctacaactcgattgagggg
gagtattgccaaattgaaaccgcctcgggaaaaatgtacacaggcacaatcttaatgcat
caaacgtctgtgcacgtatacaaagacgcgggaaaggctgagcggaatcaagagaatatg
gagatccgcctagatgaacctgttcactgccggaaagatacggaggagcttggcattggc
gtcggagactttgtgtcgtttgatccacgtgtcgagatcacatcaagcggatttattaaa
tcgcgccatttggatgacaaagcaagcgtcgccttattgctccgcttaattcatgaaatt
caaacagaagacattgagctgccgtatacaacccattttcttatttccaataatgaagaa
atcggttacggcgggaattcgaatattcctcctgaaacagttgaatatttggcggttgat
atgggcgctatcggtgacgggcaggcgacggatgaatattcagtatcaatctgtgtgaag
gatgcgagcgggccgtatcattatcagctcagaaagcatttagttcaattagccgagaag
catcatattgactataagcttgatatatatccgtactacgggtctgatgcgtcagcagcg
atcaaatccgggcatgatattgtgcatggcctcatagggccgggaattgacgcttcccat
gcatttgaacgcacccataaatcatctcttcgccataccgctaagcttctgtattactat
gtacagtcaccaatggtataa

DBGET integrated database retrieval system