KEGG   Bacillus subtilis subsp. subtilis 168: BSU10210
Entry
BSU10210          CDS       T00010                                 

Symbol
yhfF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ASCH UAE_UbL
Other DBs
NCBI-GeneID: 939309
NCBI-ProteinID: NP_388902
Pasteur: BG13052
BSORF: BG13052
UniProt: O07604 A0A6M3Z9J3
Position
1096116..1096523
AA seq 135 aa
MKIYKLKSTFGWEGDDGLGEQLIQQILAGEKSATCAPKSLYSKDELRDVYQTAGQLVTVY
DKHDNPRCNIKVTDVFETTFGAPDMRLVKGEGNGDRIEEFQEDHRMAWAELIKSGELELN
EDTVLITELFVLVKD
NT seq 408 nt   +upstreamnt  +downstreamnt
atgaagatttataagctgaaaagcacattcggttgggaaggtgatgacgggttgggagaa
cagctgattcagcagatccttgccggagaaaaaagcgccacgtgcgcgccgaaatcattg
tattcaaaagatgaattgagggacgtttatcaaacagcgggtcagcttgttaccgtttat
gataaacatgacaatccaagatgcaatataaaagtaacagatgtctttgaaaccaccttt
ggtgcgcctgatatgaggttagtcaaaggagagggcaatggagaccgaattgaggagttt
caagaggatcatcggatggcatgggcggaactgatcaaaagcggtgaactggagctgaat
gaggatactgttttgattacagagttgtttgtgcttgttaaagattaa

DBGET integrated database retrieval system