KEGG   Bacillus subtilis subsp. subtilis 168: BSU10220
Entry
BSU10220          CDS       T00010                                 

Symbol
gltT
Name
(RefSeq) proton/sodium-glutamate symport protein
  KO
K11102  proton glutamate symport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10220 (gltT)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU10220 (gltT)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 939770
NCBI-ProteinID: NP_388903
Pasteur: BG12595
BSORF: BG12595
UniProt: O07605 A0A6M4JGP2
Position
complement(1096560..1097849)
AA seq 429 aa
MKRIKFGLATQIFVGLILGVIVGVIWYGNPALPTYLQPIGDLFLRLIKMIVIPIVVSSLI
IGVAGAGNGKQVGKLGFRTILYFEIITTFAIILGLALANIFHPGTGVNIHEAQKSDISQY
VETEKEQSNKSVAETFLHIVPTNFFQSLVEGDLLAIICFTVLFALGISAIGERGKPVLAF
FEGVSHAMFHVVNLVMKVAPFGVFALIGVTVSKFGLGSLISLGKLVGLVYVALAFFLIVI
FGIVAKIAGISIFKFLAYMKDEILLAFSTSSSETVLPRIMEKMEKIGCPKGIVSFVIPIG
YTFNLDGSVLYQSIAALFLAQVYGIDLTIWHQITLVLVLMVTSKGMAAVPGTSFVVLLAT
LGTIGVPAEGLAFIAGVDRIMDMARTVVNLTGNALAAVVMSKWEGMFNPAKAETVMSQSK
TEQNATISG
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaaaagaattaagtttggattagccacacaaatattcgttggacttattctaggtgtc
attgttggcgtcatttggtatggcaacccagcattgcctacttacctgcagccaatcggg
gatctctttttacgcttaatcaaaatgatagtgattcctattgttgtctccagcttaatc
atcggtgtagccggtgcaggaaatggaaagcaagtcggtaaattaggcttcagaacgatt
ctgtacttcgagatcatcacgacttttgccattattctcggactagcccttgcaaacatc
ttccatccgggtacaggagttaatatacacgaagctcaaaaatcggacatcagtcaatat
gttgaaactgaaaaagaacaaagtaataaatcagtggcggaaacgttcctccatattgtg
ccgacaaacttcttccagtcattggtcgaaggggatcttctagccatcatctgctttaca
gtactatttgcattgggtatttccgcgatcggtgaaagaggcaagcctgtattagccttt
tttgaaggtgtatcccatgccatgttccacgttgtaaaccttgtgatgaaagtggcgcca
ttcggcgttttcgctcttatcggagtgactgtgtctaaattcggactcggttctcttatc
tctctcggaaagctcgtcggattggtttatgtcgcgcttgctttcttcttaattgttatt
ttcgggattgtcgcaaaaattgccggcatcagcatcttcaagttccttgcttacatgaag
gacgaaatcttactggcgttcagtacgtccagctctgaaacggttcttccgcgtatcatg
gaaaaaatggagaaaatcggatgtccaaaaggcattgtttcatttgtcattccgatcggt
tacacgtttaacttagacggttccgttctctatcaatctattgccgcactctttttagca
caggtatatggcattgatttgacgatttggcaccaaattacgcttgtgctcgtcttaatg
gtgacatccaaagggatggctgccgtacctggtacttcttttgttgtcttgcttgcaacg
cttggcaccatcggcgttccggctgaaggacttgcctttattgccggcgtagaccgcatc
atggatatggcacgtacagttgtcaacctgactggtaacgcgcttgctgccgttgtgatg
tctaaatgggaaggcatgtttaatcctgcgaaagcagaaactgttatgtcccaatcgaaa
acagaacaaaacgcaaccatttctggttaa

DBGET integrated database retrieval system