KEGG   Bacillus subtilis subsp. subtilis 168: BSU10230
Entry
BSU10230          CDS       T00010                                 

Symbol
yhfH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YhfH OrfB_Zn_ribbon zf-dskA_traR DUF2256 DUF2688 DZR_2
Other DBs
NCBI-GeneID: 936305
NCBI-ProteinID: NP_388904
Pasteur: BG13053
BSORF: BG13053
UniProt: O07606 A0A6M4JH45
Position
complement(1098120..1098260)
AA seq 46 aa
MVMLGKITEFFRNLPSKKCAECGKKIEEQHECYGNICNDCIKVNDL
NT seq 141 nt   +upstreamnt  +downstreamnt
ttggttatgctggggaaaatcacagaattttttagaaacctgccttcgaaaaagtgtgcg
gaatgcggaaaaaagatagaagagcagcatgagtgttatggtaatatctgcaatgactgt
ataaaagtaaacgatttgtaa

DBGET integrated database retrieval system