KEGG   Bacillus subtilis subsp. subtilis 168: BSU10240
Entry
BSU10240          CDS       T00010                                 

Symbol
yhfI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B_2 Lactamase_B Lactamase_B_3
Other DBs
NCBI-GeneID: 936318
NCBI-ProteinID: NP_388905
Pasteur: BG13054
BSORF: BG13054
UniProt: O07607 A0A6M3Z947
Structure
PDB: 
6KNS 6KNT

Position
1098412..1099146
AA seq 244 aa
MKVTVIGCYGGFPAANEATSGYLFQSGDYSLLVDCGSAVLSKLFGYVPAEKLDAVVLSHY
HHDHIADIGPLQFAKQVGSFLGKGEHTLPIYGHDADIEQFQKLTYKTHTKGIAYQPDQPL
TAGPFTITFLKTIHPVTCYAMRITDGSHTVVYTADSSYQDSFIPFSKDADLLISECNFYA
DQDGTSAGHMNSLEAGRIAKEAGAGELLLTHLPHFGVHDNLRKEAKTVFNGEVNIAKSGF
VWEG
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaaagttacagttatcggatgctatggcggttttccggccgcaaatgaagcgacgtca
ggctatttgtttcagtcaggtgattactctctgcttgttgattgcggcagtgccgtattg
tctaagctgttcggatatgtgccggcggaaaagctggatgcggtcgttctgtctcattat
caccatgaccatatcgctgatatcggaccgctgcaatttgccaagcaagtcggttcgttt
ctcggcaaaggagagcatacgcttccgatttacggacatgatgctgatatagaacagttt
caaaagcttacatataaaacacatacaaaagggatcgcctatcagccggatcagccgctg
actgccggtccgtttacgatcacctttttaaaaacgattcacccggtgacgtgctatgcc
atgcggattactgacggcagccacactgtcgtttatactgctgattccagctatcaggat
tcatttataccgttttcgaaagatgctgatttattgatctcagaatgcaatttttatgcc
gatcaagacggaacaagtgcaggccatatgaacagcctggaagctgggcgcattgcaaaa
gaagccggagcgggagaactgctgctgacacatttgccgcattttggcgtgcatgacaac
cttcgcaaagaagcgaaaaccgtttttaacggagaagtgaatattgcgaaatcaggtttt
gtgtgggaaggataa

DBGET integrated database retrieval system