KEGG   Bacillus subtilis subsp. subtilis 168: BSU10260
Entry
BSU10260          CDS       T00010                                 

Gene name
yhfK
Definition
(RefSeq) sugar epimerase YhfK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD Semialdhyde_dh DapB_N NAD_binding_4 Ldh_1_N RmlD_sub_bind
Other DBs
NCBI-GeneID: 936309
NCBI-ProteinID: NP_388907
Pasteur: BG13056
BSORF: BG13056
UniProt: O07609 A0A6M3Z944
Position
1100219..1100863
AA seq 214 aa
MKVFLIGANGQIGQRLVSLFQDNPDHSIRAMVRKEEQKASLEAAGAEAVLANLEGSPEEI
AAAAKGCDAIIFTAGSGGSTGYDKTLLVDLDGAAKAIEAAAIAGIKRFIMVSALQAHNRE
NWNEALKPYYVAKHYADKILEASGLTYTIIRPGGLRNEPGTGTVSAAKDLERGFISRDDV
AKTVIASLDEKNTENRAFDLTEGDTPIAEALKKL
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaaagtgtttttaatcggagcgaacggacaaatcgggcaaagactcgtctctttattc
caagataatcctgatcattccatcagagcgatggtcagaaaagaagaacagaaagcgtct
cttgaagctgccggtgcagaagctgtgcttgcgaatctggagggcagcccggaagaaatc
gccgctgcggcaaaaggttgtgacgcgatcattttcacagccggttccggcggcagcaca
ggctatgataaaacgctgctggtggatcttgatggagcggcaaaagccattgaagctgcg
gccattgccggaatcaaacggtttattatggtcagcgccctgcaagcccataaccgtgaa
aattggaatgaggcactcaagccttattatgtggccaagcattatgctgataaaattctg
gaagcgagcggtttaacctatacgattatccgtccgggaggccttcgcaatgagcctgga
acgggaactgtttcagcagcgaaggatctggagcggggatttatttcccgtgatgacgtt
gcaaaaacggtcattgcctctttagatgagaagaatacggaaaatcgggcctttgatctg
acagaaggagatacgccgattgccgaagcattgaagaaactatga

DBGET integrated database retrieval system