KEGG   Bacillus subtilis subsp. subtilis 168: BSU10270
Entry
BSU10270          CDS       T00010                                 

Symbol
yhfL
Name
(RefSeq) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00071  Fatty acid degradation
bsu01100  Metabolic pathways
bsu01212  Fatty acid metabolism
bsu02024  Quorum sensing
Module
bsu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU10270 (yhfL)
   00071 Fatty acid degradation
    BSU10270 (yhfL)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU10270 (yhfL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU10270 (yhfL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU10270 (yhfL)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BSU10270 (yhfL)
Lipid biosynthesis proteins [BR:bsu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BSU10270 (yhfL)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BSU10270 (yhfL)
  Exosomal proteins of breast cancer cells
   BSU10270 (yhfL)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Other DBs
NCBI-GeneID: 939308
NCBI-ProteinID: NP_388908
Pasteur: BG13057
BSORF: BG13057
UniProt: O07610 A0A6M3ZCJ6
Position
1100980..1102521
AA seq 513 aa
MNLVSKLEETASEKPDSIACRFKDHMMTYQELNEYIQRFADGLQEAGMEKGDHLALLLGN
SPDFIIAFFGALKAGIVVVPINPLYTPTEIGYMLTNGDVKAIVGVSQLLPLYESMHESLP
KVELVILCQTGEAEPEAADPEVRMKMTTFAKILRPTSAAKQNQEPVPDDTAVILYTSGTT
GKPKGAMLTHQNLYSNANDVAGYLGMDERDNVVCALPMFHVFCLTVCMNAPLMSGATVLI
EPQFSPASVFKLVKQQQATIFAGVPTMYNYLFQHENGKKDDFSSIRLCISGGASMPVALL
TAFEEKFGVTILEGYGLSEASPVTCFNPFDRGRKPGSIGTSILHVENKVVDPLGRELPAH
QVGELIVKGPNVMKGYYKMPMETEHALKDGWLYTGDLARRDEDGYFYIVDRKKDMIIVGG
YNVYPREVEEVLYSHPDVKEAVVIGVPDPQSGEAVKGYVVPKRSGVTEEDIMQHCEKHLA
KYKRPAAITFLDDIPKNATGKMLRRALRDILPQ
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaatcttgtttcaaaattggaagaaacagcatctgagaagcccgacagcatcgcatgc
aggtttaaagatcacatgatgacgtatcaagagctgaatgaatatattcagcgatttgcg
gacggccttcaggaagccggtatggagaaaggggaccatttagctttgctgcttggcaat
tcgcctgattttatcatcgcgttttttggcgctttaaaagctgggatcgtagttgttccc
atcaatccgttgtacacgccgacagaaattggttatatgctgacaaatggcgatgtaaag
gcaatcgtgggcgttagccagcttttgccgctttatgagagcatgcatgaatcgctgcca
aaggttgagctcgtcattttatgccagacgggggaggccgagccggaagctgcggaccca
gaggtcaggatgaaaatgacaacgtttgcaaaaatattgcggccgacatctgccgctaaa
caaaaccaagaacctgtacctgatgataccgcggttattttatatacgtcaggaacgact
ggaaaaccgaaaggcgcgatgctgacacatcagaatttgtacagcaatgccaacgatgtc
gcaggctatttgggaatggatgagagggacaatgtggtctgcgctcttcccatgtttcac
gtgttttgtttaaccgtctgtatgaatgcaccgctgatgagcggcgcaactgtattgatt
gagcctcaattcagtccggcatctgtttttaagcttgttaagcagcagcaggcgaccatt
tttgccggtgtgcctacaatgtataactacttgtttcagcatgaaaacggaaagaaagat
gatttttcttcgatccggctgtgcatttcgggaggcgcgtccatgccagtcgcgttgctg
acggcgtttgaagaaaaattcggtgttaccattttggaaggctacgggctctcggaagca
tcacccgtcacgtgctttaacccgtttgacaggggcagaaagccgggctccatcgggaca
agtatcttacatgtcgaaaacaaggtcgtagatccgctcggacgcgagctgcccgctcac
caggtcggcgaattgatcgtgaaaggccccaatgtgatgaagggctattataaaatgccg
atggaaacagagcatgcattaaaagacgggtggctttatacgggggacttggcaagacgg
gatgaggacggctatttttacattgttgaccggaaaaaagacatgatcattgtaggagga
tacaatgtgtatccgcgggaggtggaggaggtgctgtacagccatccggacgtcaaggag
gcggttgtcatcggcgtgccggacccccaaagcggggaagcggtaaagggatatgtggtg
ccgaaacgctctggggtaacagaggaggacatcatgcagcactgcgaaaagcatctggca
aaatacaagcggcctgccgccattacgtttcttgacgatattccgaaaaatgcgacgggg
aaaatgctcagacgggcactgagagatattttgccccaataa

DBGET integrated database retrieval system