KEGG   Bacillus subtilis subsp. subtilis 168: BSU10280
Entry
BSU10280          CDS       T00010                                 

Symbol
yhfM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Focal_AT zf-CHC2 S_100
Other DBs
NCBI-GeneID: 936312
NCBI-ProteinID: NP_388909
Pasteur: BG13058
BSORF: BG13058
UniProt: O07611 A0A6M3Z9H5
Position
complement(1102560..1102955)
AA seq 131 aa
MKKIVAAIVVIGLVFIAFFYLYSRSGDVYQSVDADLITLSSSGQEDIEIEKRQHVKDMLD
IMNQGKQVKTEKTSAPDYEGTIKFHKDRYDSFRLWIDGSQQAVFLKDGTYYKLSKNDTKA
LLNIIKKEAKD
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaaaaaatagtggcagccatcgtggtaatcggtcttgtgtttatcgcatttttttat
ctttacagccgatcaggcgatgtgtatcaatcggtagacgcggatttgatcacactgtct
tcaagcggccaggaagatatcgagattgaaaaaagacagcacgtcaaagatatgctggat
attatgaatcagggaaaacaggtgaagacagaaaaaacatcagcccctgattacgaaggg
acaatcaagtttcataaagaccggtatgactcattcagactatggattgacggcagccag
caagccgtttttttgaaggatggcacatactacaaattaagcaaaaatgatacaaaggcg
ctgctaaatattattaaaaaagaagcaaaggattga

DBGET integrated database retrieval system