KEGG   Bacillus subtilis subsp. subtilis 168: BSU10310
Entry
BSU10310          CDS       T00010                                 

Symbol
yhfO
Name
(RefSeq) N-acetyltransferase YhfO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_8 Acetyltransf_3 Acetyltransf_9 FR47 Acetyltransf_CG Acetyltransf_18 DUF4821
Other DBs
NCBI-GeneID: 939778
NCBI-ProteinID: NP_388912
Pasteur: BG13059
BSORF: BG13059
UniProt: O07614 A0A6M3Z9K1
Position
1106003..1106452
AA seq 149 aa
MNIRQAKTSDAAAIAPLFNQYREFYRQASDLQGAEAFLKARLENHESVILIAEENGEFIG
FTQLYPTFSSVSMKRIYILNDLFVVPHARTKGAGGRLLSAAKDYAGQNGAKCLTLQTEHH
NRKARSLYEQNGYEEDTGFVHYCLNVPAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaacattcgccaagcaaagacatcagatgcggccgccattgcgccgctgtttaaccaa
tatcgggaattttatagacaggcatccgatttgcaaggggcagaggcttttttgaaagct
cgtttggaaaatcacgagtctgttattttgatagcagaagaaaatggagaattcataggc
tttacccagctctatccaacgttttcttctgtgtcaatgaaaaggatatacatattaaat
gacttatttgtcgttcctcatgcgcgtacaaagggagccggcggccggctgctttctgcc
gcaaaggattatgcagggcaaaacggggcaaaatgtttaacacttcagactgagcaccac
aaccggaaggcaagaagcttgtatgagcaaaacggctatgaagaggataccggatttgtc
cattattgtctcaatgtgccggcgaagtga

DBGET integrated database retrieval system