KEGG   Bacillus subtilis subsp. subtilis 168: BSU10330
Entry
BSU10330          CDS       T00010                                 

Symbol
yhfQ
Name
(RefSeq) ABC transporter substrate-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10330 (yhfQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BSU10330 (yhfQ)
SSDB
Motif
Pfam: Peripla_BP_2 DUF4969 Nuf2_DHR10-like FapA
Other DBs
NCBI-GeneID: 936324
NCBI-ProteinID: NP_388914
Pasteur: BG13061
BSORF: BG13061
UniProt: C0SP94 A0A6M3Z957
Position
1107733..1108704
AA seq 323 aa
MKKTLIILTVLLLSVLTAACSSSSGNQNSKEHKVAVTHDLGKTNVPEHPKRVVVLELGFI
DTLLDLGITPVGVADDNKAKQLINKDVLKKIDGYTSVGTRSQPSMEKIASLKPDLIIADT
TRHKKVYDQLKKIAPTIALNNLNADYQDTIDASLTIAKAVGKEKEMEKKLTAHEEKLSET
KQKISANSQSVLLIGNTNDTIMARDENFFTSRLLTQVGYRYAISTSGNSDSSNGGDSVNM
KMTLEQLLKTDPDVIILMTGKTDDLDADGKRPIEKNVLWKKLKAVKNGHVYHVDRAVWSL
RRSVDGANAILDELQKEMPAAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaaaaaaacactgattattcttacagttttacttctttctgtcttaacggctgcttgc
tcgtcttcaagcggcaatcaaaacagtaaagaacataaagtggcggtaacacatgattta
gggaagacaaatgtgcctgagcatccgaagcgggttgttgttcttgagctaggttttatt
gatacactgcttgatctcggcattacgcctgtcggggttgccgatgacaacaaagcgaag
cagctgatcaacaaggatgtgctgaagaaaattgacggctacacatctgtcggcactcgc
tcacagccaagcatggaaaaaatcgcttcattaaaacccgatttaattattgctgacacg
acccggcataagaaggtgtacgatcagctgaaaaaaatagcgccgacgattgcacttaat
aatttaaatgctgattatcaggatacaattgacgcttcgcttacgattgcaaaagcagtc
ggcaaggagaaggaaatggagaaaaagctgacggcgcatgaagaaaagcttagcgagaca
aagcagaaaatcagcgcgaacagccagtccgtgcttttgatcggaaatacaaatgatacc
attatggccagggatgaaaacttctttacatcgagacttttaacacaggtcggctaccga
tatgcaatcagtacgtcaggcaatagcgattcaagcaatggcggcgactctgtgaatatg
aaaatgacactggagcagctgctgaaaacagatccggatgtgatcatcctgatgacagga
aaaacagatgacctcgacgccgacggtaaacgcccgatcgaaaagaatgtcctttggaaa
aaactgaaggcagtgaaaaacgggcatgtataccacgtggatcgtgcggtgtggtctctg
cgccgcagtgtagacggggcgaatgccattttggacgagcttcaaaaagagatgccggct
gctaagaaataa

DBGET integrated database retrieval system