KEGG   Bacillus subtilis subsp. subtilis 168: BSU10340
Entry
BSU10340          CDS       T00010                                 

Symbol
phoE
Name
(RefSeq) phosphatase PhoE
  KO
K15640  uncharacterized phosphatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU10340 (phoE)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 939773
NCBI-ProteinID: NP_388915
Pasteur: BG13062
BSORF: BG13062
UniProt: O07617 A0A6M4JH49
Position
complement(1108736..1109317)
AA seq 193 aa
MTAVCLVRHGETDWNLQQKCQGKTDIPLNATGERQARETGEYVKDFSWDIIVTSPLKRAK
RTAEIINEYLHLPIVEMDDFKERDYGDAEGMPLEERTKRYPDNIYPNMETLEELTDRLMG
GLAKVNQAYPNKKVLIVAHGAAIHALLTEISGGDPELQSTRLVNACLSNIEFAEEKWRIK
DYNINSHLSGFIK
NT seq 582 nt   +upstreamnt  +downstreamnt
atgacagccgtttgtttagtaagacatggagaaaccgattggaacctgcagcaaaaatgc
caaggcaaaaccgatatcccgctaaacgcaacaggtgaacgccaagcaagagaaaccgga
gaatatgtaaaggacttttcttgggatattattgtgacgagcccgctgaaaagagcgaaa
agaaccgcggaaattattaatgaatatctgcatcttccgatagtcgagatggatgatttt
aaggaacgcgattacggcgacgcggagggcatgccgctggaggaacggacaaagcgctat
ccagataacatctatccgaatatggaaaccttagaagaactcactgacaggctgatgggc
ggtttggcaaaagtgaatcaggcgtatccaaacaagaaggtgctgatcgtggcgcacggt
gcggcaattcacgccctgctgacagaaatatccggcggtgacccggagcttcaaagcacc
cgtctcgtcaacgcctgcctcagcaacattgaatttgcagaagaaaaatggcggataaaa
gactataatatcaacagccacttatccggctttatcaaataa

DBGET integrated database retrieval system