KEGG   Bacillus subtilis subsp. subtilis 168: BSU10350Help
Entry
BSU10350          CDS       T00010                                 

Gene name
yhfS
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00071  Fatty acid degradation
bsu00072  Synthesis and degradation of ketone bodies
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00362  Benzoate degradation
bsu00380  Tryptophan metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu00650  Butanoate metabolism
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU10350 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU10350 (yhfS)
   00640 Propanoate metabolism
    BSU10350 (yhfS)
   00650 Butanoate metabolism
    BSU10350 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU10350 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BSU10350 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU10350 (yhfS)
   00310 Lysine degradation
    BSU10350 (yhfS)
   00380 Tryptophan metabolism
    BSU10350 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU10350 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU10350 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU10350 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU10350 (yhfS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSU10350 (yhfS)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU10350 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 939311
NCBI-ProteinID: NP_388916
Pasteur: BG13063
BSORF: BG13063
UniProt: O07618
Position
complement(1109388..1110482)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDEGFYREEVVALGE
LETDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNFPPAAPVVAIRQLLHTHDVTPDDIDLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRPDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctactggcagaggcggcaacctggcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gctcgcttttctccagatgcgatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatgaaggattttaccgtgaagaagttgttgctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagtggcatagca
gacggagcagccgctcttttggtaatggaagaagaaaaagcagcagccctgggacttaag
cctgtgcttcggtttatcggcagcgctgtcagcggcattcaccccaactttccgcccgcg
gcaccggttgtcgcgattcgtcagctcttacatacacacgatgtaacacctgatgatatc
gatttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgccttagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggccagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system