KEGG   Bacillus subtilis subsp. subtilis 168: BSU10370Help
Entry
BSU10370          CDS       T00010                                 

Gene name
bioY
Definition
(RefSeq) biotin transporter BioY
  KO
K03523  biotin transport system substrate-specific component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU10370 (bioY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10370 (bioY)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter
    BSU10370 (bioY)
   Energy-coupling factor transporter
    Substrate-specific components
     BSU10370 (bioY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BioY DPBB_1 IBV_3C ECF-ribofla_trS
Motif
Other DBs
NCBI-GeneID: 939321
NCBI-ProteinID: NP_388918
Pasteur: BG13065
BSORF: BG13065
UniProt: O07620
Position
complement(1111925..1112485)
Genome map
AA seq 186 aa AA seqDB search
MLKLIDMMHIAIFTALMAVLGFMPPLFLSFTPVPITLQTLGVMLAGSILRPKSAFLSQLV
FLLLVAFGAPLLPGGRGGFGVFFGPSAGFLIAYPLASWLISLAANRLRKVTVLRLFFTHI
VFGIIFIYLLGIPVQAFIMHIDLSQAAFMSLAYVPGDLIKAAVSAFLAIKITQALSLSDT
MFTKGG
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaattaatcgacatgatgcatattgcgattttcaccgcgctgatggcagtgctc
ggctttatgccccctctcttcttatcctttacacccgttccgattacattgcaaacgctt
ggtgtcatgttggcaggcagcattctcaggccaaagtctgctttcttaagccagcttgtc
tttttgctgctcgtcgccttcggagcgccgctgttgcccggcggacgaggcggttttggt
gtgtttttcggaccgagcgcaggctttttgattgcttatcccctcgcttcatggctgatc
agtttagccgctaacaggctgcggaaggtgacagtattgcgtctctttttcactcatatc
gtattcggcatcatctttatttatctgcttggtataccggtacaagcttttatcatgcat
attgatttgtcacaggccgccttcatgagccttgcatatgtgcctggtgatttgataaaa
gcggctgtatctgcatttctggcgataaaaatcactcaagccttgtctctttctgatacg
atgtttacaaaaggaggatga

DBGET integrated database retrieval system