KEGG   Bacillus subtilis subsp. subtilis 168: BSU10390
Entry
BSU10390          CDS       T00010                                 

Symbol
yhfW
Name
(RefSeq) rieske 2Fe-2S iron-sulfur protein YhfW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DAO Rieske NAD_binding_8 FAD_binding_3 FAD_binding_2 FAD_oxidored Thi4 Pyr_redox_2 HI0933_like Pyr_redox_3 GIDA TrkA_N Pyr_redox Lycopene_cycl Amino_oxidase NAD_binding_9 Trp_halogenase 3HCDH_N ThiI
Other DBs
NCBI-GeneID: 936319
NCBI-ProteinID: NP_388920
Pasteur: BG13067
BSORF: BG13067
UniProt: O07622 A0A6M3ZEF7
Position
complement(1114057..1115586)
AA seq 509 aa
MANQHFAKEAPETYWKTSTDLPSFPALQEDTECDVTIIGGGITGITTAYELTKRGFRVVL
IEANQVLNGTTAHTTAKVTAQHDMIYDEFIRHFGLNHARLYYEANQNAIDYIKGIVDEHQ
IDCEWIEQDAYLYTANENAVQKIHTEHEAYTKLGIERDLIKDLPIPLGSKLALVMKNQAQ
FHPLQYLKALLEQIVQKGGRIYEETVALDIKKGERPEVVTKSRHAIKSRFIICCSHFPFY
DGGGLYAARMYSDRSYVLAIKPKIEYPEGMYLSIDQPSVALRYTVVNGEKLILFSGVSHK
TGQGKAMSTHYETLRQLAESTIGIESIPYYWSTQDLVTIDKIPFIGPMSENEDNILVATG
FKKWGMTSSAVAATLLSDLVEKKENPYESIFTPSRFHLNPGLQKVISYNADVAKHLIKGK
LEKPDVQFEDISPGEGKAVTINGRRAGAFRDETGCLHLVDTTCTHLGCEVEWNDSEHTWD
CPCHGSRFKPSGEVVEGPAIKPLKQIDLD
NT seq 1530 nt   +upstreamnt  +downstreamnt
ttggctaatcaacattttgcaaaggaagcacctgaaacatactggaaaacatcaactgac
ctgccttcttttcctgcgcttcaagaggacactgaatgtgacgtcaccattatcggaggc
gggattacgggaatcacaacggcatatgaacttacgaagagaggcttccgtgtcgttttg
attgaagcaaatcaggttcttaacggaaccactgcgcatacaactgctaaagttaccgca
cagcatgacatgatatacgacgaatttatccgccatttcggattaaaccatgcgaggctt
tattatgaagcaaaccaaaacgcaattgattacataaaaggcattgtggatgaacatcaa
attgattgtgaatggatcgagcaagacgcatatctttatacggcaaatgaaaacgctgtt
caaaaaatccacaccgagcatgaggcatacacaaagctcggaattgaaagagaccttatc
aaggatcttccaattcccttaggttctaagctggcgcttgtcatgaagaatcaagctcaa
tttcatccgcttcaatacttaaaagcgcttctggagcaaattgttcaaaaaggcggccga
atttatgaagagaccgttgcgcttgatatcaaaaaaggcgaaaggcccgaagtggtaaca
aaaagccggcacgccattaagagccgctttatcatatgctgttcccacttccctttttat
gacggaggcggattatatgctgcgagaatgtactccgacagatcttatgtccttgccatc
aagccgaagatcgagtatcccgagggcatgtatttgagtatcgatcagccgtcagtggcg
ctccgctatacggttgtaaacggtgaaaagctgattctcttcagcggagtaagccataaa
acaggccagggaaaagccatgtctacacattatgaaacactgagacaactggccgaaagc
accatcggcatcgaaagcattccatattattggtccacccaagatctagtgacgatcgac
aaaatcccgtttatcgggccgatgtcggaaaatgaggacaatattctagtagcgaccggg
ttcaaaaaatggggcatgacgtcctcagcagtcgcagccactttattgtcagaccttgtg
gagaaaaaagaaaacccatacgaaagcattttcacgccgtcccgtttccatctgaatccc
gggttgcagaaagtgatttcctacaatgcagatgtcgccaagcatttgataaaaggaaag
cttgaaaagcctgatgtccaatttgaagacatttcgccaggagaagggaaagccgtcacc
ataaacggcaggcgagcgggagcatttcgtgatgagacaggctgcctccatctcgttgat
acgacttgtacccatttaggctgcgaggtcgagtggaacgacagtgagcatacgtgggat
tgtccgtgccacggatcacgctttaagccatctggcgaagttgtagagggtccggccatt
aaaccattaaaacaaatagatctcgattaa

DBGET integrated database retrieval system