KEGG   Bacillus subtilis subsp. subtilis 168: BSU10400
Entry
BSU10400          CDS       T00010                                 

Symbol
yhxC
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 GDP_Man_Dehyd Polysacc_synt_2 2-Hacid_dh_C THF_DHG_CYH_C Epimerase Thioredoxin_8
Other DBs
NCBI-GeneID: 939316
NCBI-ProteinID: NP_388921
Pasteur: BG11058
BSORF: BG11058
UniProt: P40397 A0A6M3Z9Q0
Position
1115698..1116555
AA seq 285 aa
MANQKKKTLPPQHQNQQPGFEYLMDPRPVFDKPKKAKKLEGKTAIITGGDSGIGRAVSVL
FAKEGANVVIVYLNEHQDAEETKQYVEKEGVKCLLIAGDVGDEAFCNDVVGQASQVFPSI
DILVNNAAEQHVQPSIEKITSHQLIRTFQTNIFSMFYLTKAVLPHLKKGSSIINTASITA
YKGNKTLIDYSATKGAIVTFTRSLSQSLVQQGIRVNAVAPGPIWTPLIPASFAAKDVEVF
GSDVPMERPGQPVEVAPSYLYLASDDSTYVTGQTIHVNGGTIVNG
NT seq 858 nt   +upstreamnt  +downstreamnt
ttggcgaatcaaaaaaagaaaacattaccgcctcagcaccagaaccagcagcctggtttt
gaatatctgatggacccgcgtccggtttttgataagccgaagaaagcgaaaaaattagag
ggcaaaaccgctattattactggaggagacagcgggattggacgcgctgtctcggtgtta
ttcgcaaaagaaggggctaatgtggtcattgtgtatttgaatgaacatcaggacgccgag
gaaacaaagcagtatgtagaaaaggaaggggtaaaatgcctgctgattgcaggagatgtc
ggggatgaagcgttttgcaatgatgtggtcgggcaggcaagccaagtgtttccatccatt
gatatattggttaacaatgcagctgagcagcatgtccagcccagcattgaaaaaatcacc
agccaccagctgatcagaaccttccaaacaaacattttttccatgttttacttaacaaag
gcagtgctgcctcatttaaaaaaagggagctctattattaataccgcttcaattaccgcc
tataaaggcaataaaacgctgatcgattattcagcgacaaaaggcgcgatcgttacgttt
acaaggtccctttcccagtcgcttgttcagcagggcatacgggtcaatgcagtggcaccg
ggtcccatttggacaccgcttatcccggccagctttgccgcaaaagacgtggaagtgttt
ggttcagacgtgccgatggaacgcccggggcagccggtcgaagtggcgccaagctatcta
taccttgccagcgacgattccacatacgtcacagggcagacgattcacgtcaatggcgga
acaattgtgaacggataa

DBGET integrated database retrieval system