KEGG   Bacillus subtilis subsp. subtilis 168: BSU10410
Entry
BSU10410          CDS       T00010                                 

Symbol
yhzC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: IDEAL PLA2_B DUF3280
Other DBs
NCBI-GeneID: 939319
NCBI-ProteinID: NP_388922
Pasteur: BG13087
BSORF: BG13087
UniProt: O31594 A0A6M3Z9L0
Position
complement(1116583..1116816)
AA seq 77 aa
MKEKKSYTELMKSRNTQKTKEFDVTMTDIYIQMVLDESLYNRRLAMLTDQINKALDEKDK
DAFLTLSKEYAALKQSE
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaaagagaaaaaatcgtacactgagctcatgaagtcccgcaacacgcaaaaaacaaaa
gaattcgatgtcacaatgacggatatttacattcaaatggtgctcgatgaatccttgtat
aaccgtcggcttgccatgctgacggaccaaattaacaaagccttggacgaaaaagataaa
gatgcgtttcttacgctctctaaagaatatgcagcgctcaagcagagcgaataa

DBGET integrated database retrieval system