KEGG   Bacillus subtilis subsp. subtilis 168: BSU10420
Entry
BSU10420          CDS       T00010                                 

Symbol
comK
Name
(RefSeq) competence transcription factor
  KO
K02250  competence protein ComK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU10420 (comK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU10420 (comK)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU10420 (comK)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU10420 (comK)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BSU10420 (comK)
SSDB
Motif
Pfam: ComK V-set
Other DBs
NCBI-GeneID: 936338
NCBI-ProteinID: NP_388923
Pasteur: BG11059
BSORF: BG11059
UniProt: P40396 A0A6M3Z9C6
Position
1117109..1117687
AA seq 192 aa
MSQKTDAPLESYEVNGATIAVLPEEIDGKICSKIIEKDCVFYVNMKPLQIVDRSCRFFGS
SYAGRKAGTYEVTKISHKPPIMVDPSNQIFLFPTLSSTRPQCGWISHVHVKEFKATEFDD
TEVTFSNGKTMELPISYNSFENQVYRTAWLRTKFQDRIDHRVPKRQEFMLYPKEERTKMI
YDFILRELGERY
NT seq 579 nt   +upstreamnt  +downstreamnt
atgagtcagaaaacagacgcacctttagaatcgtatgaagtgaacggcgcaacaattgcc
gtgctgccagaagaaatagacggcaaaatctgttccaaaattattgaaaaagattgcgtg
ttttatgtaaacatgaagccgctgcaaattgtcgacagaagctgccgattttttggatca
agctatgcgggaagaaaagcaggaacttatgaagtgacaaaaatttcacacaagccgccg
atcatggtggacccttcgaaccaaatctttttattccctacactttcttcgacaagaccc
caatgcggctggatttcccatgtgcatgtaaaagaattcaaagcgactgaattcgacgat
acggaagtgacgttttccaatgggaaaacgatggagctgccgatctcttataattcgttc
gagaaccaggtataccgaacagcgtggctcagaaccaaattccaagacagaatcgaccac
cgcgtgccgaaaagacaggaatttatgctgtacccgaaagaagagcggacgaagatgatt
tatgattttattttgcgtgagctcggggaacggtattag

DBGET integrated database retrieval system