KEGG   Bacillus subtilis subsp. subtilis 168: BSU10430
Entry
BSU10430          CDS       T00010                                 

Symbol
yhxD
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Eno-Rase_NADH_b
Other DBs
NCBI-GeneID: 939776
NCBI-ProteinID: NP_388924
Pasteur: BG11060
BSORF: BG11060
UniProt: P40398 A0A6M4JER5
Position
complement(1117734..1118633)
AA seq 299 aa
MSDSNLTNPIKAFFHDEFPEQYQEPPGLQKNMKPVPDCGEKSYKGSGKLTGRKALVTGGD
SGIGRAAAIAYAREGADVAINYLPEEQPDAEEVKELIEAEGRKAVLIPGDLSDESFCQDL
VKQSHHELGGLDVLALVAGKQQAVENIEDLPTEQIYKTFEVNVFSLYWVVKAALPYLPEG
ASIITTTSVEGYNPSPMLLDYAATKNAIIGFTVGLGKQLASKGIRVNSVAPGPIWTPLQI
SGGQPTENIPKFGQGTPPAPLNRAGQPVELADVYVFLASENSSYVTSQVYGITGGIPTA
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtctgattcaaatcttacgaatcctataaaagcattttttcatgatgaatttcccgaa
caatatcaagaaccgccaggcctgcaaaagaacatgaagcctgtccctgattgcggagaa
aaaagctacaaaggatcaggtaaactaacgggtcgaaaagcgcttgtcacgggcggcgat
tccggtatcggccgcgctgccgcaattgcttacgccagagaaggtgccgatgtggctatt
aactacttgcccgaggaacagccagatgctgaagaggtaaaagagctgattgaagcagaa
ggccgaaaagcagtgctgatccccggagacttgagcgacgaatccttttgccaagatcta
gtcaaacagtcgcatcacgaactcggcggacttgatgtgctagcgctcgttgcaggcaaa
cagcaagcggtcgaaaacatcgaagatctgcctactgaacaaatctataaaacatttgaa
gtgaacgtcttttccctttactgggttgtaaaagcggcgcttccgtatttgccggaggga
gcttcaattatcacaactacctcagttgaaggctataatccaagcccgatgctgttagat
tacgcagcaacgaaaaacgccattatcggctttaccgtcggactgggaaaacagcttgct
tccaaaggcatcagagtaaattcagttgcgcccggaccaatttggacaccgctgcaaatt
tccggcggacagccgacggaaaacatcccgaaattcggacaaggcacgccgccagctcca
ttaaatcgcgctgggcagccagtggaattggccgatgtttatgtatttctagcttcagag
aattcaagctatgtgacatctcaggtatatggcatcaccggaggaattccgacggcatag

DBGET integrated database retrieval system