KEGG   Bacillus subtilis subsp. subtilis 168: BSU10440
Entry
BSU10440          CDS       T00010                                 

Symbol
yhjA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Excalibur
Other DBs
NCBI-GeneID: 936321
NCBI-ProteinID: NP_388925
Pasteur: BG13068
BSORF: BG13068
UniProt: O07555 A0A6M3Z967
Position
1118850..1119119
AA seq 89 aa
MKKAAAVLLSLGLVFGFSYGAGHVAEAKTKVKVYKNCKELNKVYKGGVARTSKVKNKGGK
TKYKPYVSKALYDANKNKDRDKDLIACER
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaagcggcggcggttttgctgtcactcggtctcgttttcggtttttcatacgga
gctggccatgtggcggaagccaaaacaaaggtgaaggtctataagaactgcaaggagcta
aacaaagtatacaaaggcggagtggcccgcacatcgaaggtgaaaaacaaaggcggaaaa
acgaagtacaagccttacgtttctaaggcactttacgatgccaataaaaacaaagaccgc
gataaagatcttatcgcctgtgaacggtaa

DBGET integrated database retrieval system