KEGG   Bacillus subtilis subsp. subtilis 168: BSU10450Help
Entry
BSU10450          CDS       T00010                                 

Gene name
yhjB
Definition
(RefSeq) symporter
  KO
K03307  solute:Na+ symporter, SSS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU10450 (yhjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 939317
NCBI-ProteinID: NP_388926
Pasteur: BG13069
BSORF: BG13069
UniProt: O07556
Position
complement(1119162..1120631)
Genome map
AA seq 489 aa AA seqDB search
MNAALIIIFGVLLLSIFLGIRAQKGKDMNLEQWTVGGRGFGTVFVFLLMAGEIYTTFTFL
GGSGWAYGKGGPAFYIIAYGCLAYILSYWLLPAVWTYAKQHKLMSQSDFFTKKYNSPLLG
ILVSLVGIAALIPYLVLQLKGLGLIVSETSYGKITPTAAIWIGAVSITVYVMVSGIHGSA
WISVVKDIMILVVVLFLGVYLPIHYYGGFQDMFQQIETAKPGFLTLPESGQSVAWFSSTV
LLTALGFYMWPHTFSASYSAENPKVFRKNAIIMPLYQLVLLFVLFVGFAAILQVPDLNGA
DGDLSLLRLSLQAFDPWFVGIIGAAGLLTALVPGSMILMSASTLFAKNVYKVIAPRTTEQ
QVSALAKFLVPVIALISVYFTFKGGNTIVTLLLMGYSLVTQLFPALLFSLLKHNMVTKQG
AFAGIIAGVGAVTYITMTETTIGTLFPALPQAAKDLNVGIVALLLNITVMMAVSLMTRKA
KSAAADQAA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagctctcatcatcatcttcggtgtcctgctcttgagtatttttctcggtata
cgcgcccaaaaaggaaaagacatgaacctggagcagtggacggtcggagggcgcggcttc
ggaactgttttcgtcttccttttgatggcaggcgaaatttatactacttttacgtttctc
ggcggcagcggctgggcctacggaaaaggcggtccagccttttatatcatcgcctacgga
tgtctggcctacatcctttcttactggcttcttccagcagtttggacgtacgcgaaacag
cataaactgatgtcgcagtctgattttttcacaaaaaaatacaacagtccgctgcttggc
attctcgtttcactggtcggcatcgccgcactcattccctatcttgtactgcagctgaaa
ggcctcgggctgattgtatcggaaacctcgtacggcaaaatcaccccgaccgctgccatc
tggatcggcgctgtttccatcacggtttatgttatggtttcaggcattcacgggtctgcc
tggatatcggttgtgaaggacatcatgattctggttgtcgttctgtttttaggtgtgtat
ttgccaattcattactacggcggatttcaagacatgtttcagcagattgaaacggcaaag
cctggctttcttacgctccccgaatcgggacaaagtgtggcctggttcagttcaaccgta
ctcttgacagcgcttggtttttacatgtggcctcacacgttttccgcttcgtattcagcc
gaaaacccaaaagtgtttcgtaaaaacgccatcatcatgcctttgtaccagctggtcctg
ctcttcgtccttttcgtcggctttgcggctatcctgcaagttccagatctgaatggcgca
gacggggatttgtcgcttttgagactgtctctgcaagcatttgacccttggtttgtcgga
attatcggtgctgccggactgctgacagcacttgtgccagggtctatgatcttaatgtcc
gcctccacactgtttgcaaaaaatgtgtacaaggtaatcgcgccccgcacgacagaacag
caagtatcggcgcttgctaagtttttagtgccggtgattgcgctgatttcggtgtatttt
accttcaaaggcgggaataccatcgttacgctgcttttgatgggctacagccttgtcaca
cagctattccccgcccttttgttcagcctgctcaagcataatatggtgacaaagcaagga
gctttcgccggcattattgcaggtgtcggagcagttacttatattacaatgacggaaacg
acgatcggcactttatttccggctctgccgcaagccgcaaaagacttgaatgtcggcatc
gtcgccctgcttttgaatatcacggtcatgatggcagtcagccttatgacaaggaaggcg
aaaagcgctgcggccgatcaggcggcctaa

DBGET integrated database retrieval system