KEGG   Bacillus subtilis subsp. subtilis 168: BSU10470
Entry
BSU10470          CDS       T00010                                 

Symbol
yhjD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Arena_nucleocap
Other DBs
NCBI-GeneID: 936334
NCBI-ProteinID: NP_388928
Pasteur: BG13071
BSORF: BG13071
UniProt: O07558 A0A6M4JGN6
Position
complement(1121036..1121398)
AA seq 120 aa
MPNLQEEIYDLIERALFLPMAITIFNRDLAGIEESTLKLKHPYKQLISESLKIAQKDLME
VRKELRKRKIAIRETERDEAFTLYTFVIDGYEENHRYFNPRIREQVSELLTYYLFAPDRL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgccaaatctgcaggaggaaatatacgatttaattgaacgggctctctttttgcccatg
gccattacgatttttaaccgtgatctcgccggaattgaagaaagcacattaaaattgaag
catccttataaacagcttatcagcgaatcattaaaaatagcacaaaaggatttgatggag
gtcagaaaagaactgaggaaaagaaaaattgcaatccgcgagacggaacgcgatgaggcc
tttacactctatacatttgtcatcgacggttatgaagaaaaccatcgctattttaatccg
cgaatccgtgagcaggtcagcgaattattaacatactatctatttgccccagacagactc
tga

DBGET integrated database retrieval system