KEGG   Bacillus subtilis subsp. subtilis 168: BSU10500
Entry
BSU10500          CDS       T00010                                 

Symbol
yhjG
Name
(RefSeq) aromatic compound monooxygenase YhjG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox DAO Pyr_redox_2 HI0933_like Trp_halogenase Pyr_redox_3
Other DBs
NCBI-GeneID: 936325
NCBI-ProteinID: NP_388931
Pasteur: BG13073
BSORF: BG13073
UniProt: O07561 A0A6M4JLT0
Position
1122862..1124361
AA seq 499 aa
MMMKYEAVIIGGGPVGFMLASELAIAGVGTCVIERLEKPVPHSKALTLHPRTLELLEMRG
ILERFVSKGSKIPTGHFSMLDTRLDFSGLDTSCPYTLLLPQSKTEKLLEDHARSLGTEVF
RGAEALAVTQNGEAVQTIFKDRDGSVRTITSKFAVGADGAGSTVRKQAKIEFPGTDSTVT
AALGDVVLLSPPPSGVLSLCTKEGGVMIVPLSPDRYRVVVISPYRTQTPKDVPVTEEELK
ADLLRICGTDFGLTDPSWMSRFGNAARQAKRYRDGRIFLAGDAAHIHFPAGGQGLNVGLQ
DAMNLGWKLAAAIKGSAPSWLLDSYHDERHPAAEGLLRNTEAQTKLIDFTQAGLHLRSMM
SELLAFPDVNRYVAGQISALDVRYEADRTMPPNRLNGARLPDMKLILSDGNSERLYSFLQ
NGTFVLLSLRQEADDHIEVKGLRTVTASLAEPNEKLRNVHTILIRPDGHVAWAVDASAPD
CSEVIQKGISRWFSVTSRV
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgatgatgaaatatgaagcagtgattataggaggagggccggttggatttatgctggct
tctgagcttgcaatagccggagtgggaacatgtgtgattgaacggcttgaaaaacctgtt
ccgcattccaaggcgttgacgctgcacccccgaacgctggagcttcttgagatgagaggg
attttagagcggttcgtatccaagggaagcaagatacctaccggacatttttcaatgctg
gatacccgtctggatttttcaggcttggatacgagctgtccttacacgcttttgctcccg
cagtccaaaacagaaaagcttcttgaagatcatgcacgaagcctgggaacagaggtgttt
cggggtgccgaggcgctggcggttacgcaaaacggggaagcggtccaaacaatttttaag
gatcgggacggcagtgtacggacgatcacaagcaagtttgccgttggggcagatggcgcc
gggagtaccgtccggaaacaggcgaaaattgagtttccgggaacagacagcactgtcacc
gctgcgcttggggatgtggtgctcctttctccgccgccgtcaggtgtgctgtccctttgc
acaaaagagggcggtgttatgattgttccgttatctccagaccgataccgtgtcgttgtg
atcagcccttatcgcacacaaacgccgaaagatgtgcctgtgactgaggaagagctgaaa
gctgacctcctgcgaatttgcggaactgacttcggtttaaccgacccttcgtggatgtcg
cggtttgggaacgccgcgcgccaagcgaaacggtatcgggacggcagaatctttcttgcg
ggtgatgccgcgcatattcattttccggcgggcgggcaaggactgaatgtcggccttcag
gatgcaatgaacctcgggtggaaactggcggcggccatcaaaggctctgcgccttcttgg
cttttggacagctaccatgatgagcggcatccggcagcggaagggctcctcagaaacacg
gaggcacagacaaagctgatcgatttcactcaagcaggcctccatttgcgaagcatgatg
tcggagctgctggccttccctgatgtgaatcgatatgtagcggggcaaatttctgcgctc
gatgtcagatatgaagctgatcgtaccatgccgccgaatcgtttgaacggggcaaggctc
cctgacatgaagctgattctttccgacggcaattcggaacggctgtacagctttctccaa
aacgggacattcgttttgctgtcattgaggcaggaagctgatgatcatatcgaagtaaaa
ggcttacgtacggtaaccgcctcgcttgcagaaccgaatgaaaagttgcggaatgtgcat
accatattgattcgtcccgatggacatgtagcctgggcggtggatgcatcagcgcccgat
tgttccgaggtgattcaaaaagggatcagccgctggttttccgtcaccagccgagtataa

DBGET integrated database retrieval system