KEGG   Bacillus subtilis subsp. subtilis 168: BSU10510
Entry
BSU10510          CDS       T00010                                 

Symbol
yhjH
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_27 MarR_2 TrmB HTH_34 HTH_24 Rrf2 Fe_dep_repress HTH_IclR Dimerisation2 SMC_ScpB HTH_Crp_2 HxlR GNAT_acetyltran RPA_C DUF2262
Other DBs
NCBI-GeneID: 939329
NCBI-ProteinID: NP_388932
Pasteur: BG13074
BSORF: BG13074
UniProt: Q796S4 A0A6M4JK82
Position
1124438..1124965
AA seq 175 aa
MNTDHTKRNLFELYAELIHQQEKWEGLIKAFLSDELRKLDVEHGSKSQLTMTEIHVLSCV
GDNEPINVTSIAEKMNTTKATVSRISTKLLGAGFLHRTQLSDNKKEVYFRLTPAGKKLHS
LHKYYHQKAEQRFLSFFDRYTEEEILFAERLFRDLVTKWYPSSEEIEGGLPSIFK
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaacacagatcatacgaaacgcaatctttttgaattgtatgcggagctcattcatcag
caggagaaatgggaggggcttattaaagcctttttatctgacgaattgaggaagctggat
gtagagcacgggagtaaatctcaattgacgatgacagaaattcatgttctatcctgtgtc
ggggacaatgaaccaattaatgtcacgtcgatagcagaaaaaatgaatacgacaaaagcg
actgtatcacgcatcagcacaaaattgctcggcgcaggcttccttcacagaacacagctc
agcgataataaaaaggaggtctacttccgattgacgcctgctggaaaaaagctgcacagt
ttgcacaaatattatcatcagaaggctgaacagcgttttctgtcattttttgaccgctat
accgaggaagagattctttttgcggaacggctgtttcgggatctggtgacaaaatggtat
ccgtcgtcagaagaaattgaaggggggcttcctagcatttttaaataa

DBGET integrated database retrieval system