KEGG   Bacillus subtilis subsp. subtilis 168: BSU10520
Entry
BSU10520          CDS       T00010                                 

Symbol
glcP
Name
(RefSeq) sugar transporter
  KO
K08174  MFS transporter, FHS family, glucose/mannose:H+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10520 (glcP)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    BSU10520 (glcP)
SSDB
Motif
Pfam: MFS_1 MFS_2
Other DBs
NCBI-GeneID: 936346
NCBI-ProteinID: NP_388933
Pasteur: BG13075
BSORF: BG13075
UniProt: O07563 A0A6M4JEN0
Position
complement(1125123..1126328)
AA seq 401 aa
MLRGTYLFGYAFFFTVGIIHISTGSLTPFLLEAFNKTTDDISVIIFFQFTGFLSGVLIAP
LMIKKYSHFRTLTLALTIMLVALSIFFLTKDWYYIIVMAFLLGYGAGTLETTVGSFVIAN
FESNAEKMSKLEVLFGLGALSFPLLINSFIDINNWFLPYYCIFTFLFVLFVGWLIFLSKN
REYAKNANQQVTFPDGGAFQYFIGDRKKSKQLGFFVFFAFLYAGIETNFANFLPSIMINQ
DNEQISLISVSFFWVGIIIGRILIGFVSRRLDFSKYLLFSCSCLIVLLIAFSYISNPILQ
LSGTFLIGLSIAGIFPIALTLASIIIQKYVDEVTSLFIASASFGGAIISFLIGWSLNQDT
ILLTMGIFTTMAVILVGISVKIRRTKTEDPISLENKASKTQ
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgttaagagggacatatttatttggatatgctttcttttttacagtaggtattatccat
atatcaacagggagtttgacaccatttttattagaggcttttaacaagacaacagatgat
atttcggtcataatcttcttccagtttaccggatttctaagcggagtattaatcgcacct
ttaatgattaagaaatacagtcattttaggacacttactttagctttgacaataatgctt
gtagcgttaagtatcttttttctaaccaaggattggtattatattattgtaatggctttt
ctcttaggatatggagcaggcacattagaaacgacagttggttcatttgttattgctaat
ttcgaaagtaatgcagaaaaaatgagtaagctggaagttctctttggattaggcgcttta
tctttcccattattaattaattccttcatagatatcaataactggtttttaccatattac
tgtatattcacctttttattcgtcctattcgtagggtggttaattttcttgtctaagaac
cgagagtacgctaagaatgctaaccaacaagtgacctttccagatggaggagcatttcaa
tactttataggagatagaaaaaaatcaaagcaattaggcttttttgtatttttcgctttc
ctatatgctggaattgaaacaaattttgccaactttttaccttcaatcatgataaaccaa
gacaatgaacaaattagtcttataagtgtctcctttttctgggtagggatcatcatagga
agaatattgattggtttcgtaagtagaaggcttgatttttccaaataccttctttttagc
tgtagttgtttaattgttttgttgattgccttctcttatataagtaacccaatacttcaa
ttgagtggtacatttttgattggcctaagtatagcggggatatttcccattgctttaaca
ctagcatcaatcattattcagaagtacgttgacgaagttacaagtttatttattgcctcg
gcaagtttcggaggagcgatcatctctttcttaattggatggagtttaaaccaggatacg
atcttattaaccatgggaatatttacaactatggcggtcattctagtaggtatttctgta
aagattaggagaactaaaacagaagaccctatttcacttgaaaacaaagcatcaaaaaca
cagtag

DBGET integrated database retrieval system