KEGG   Bacillus subtilis subsp. subtilis 168: BSU10530
Entry
BSU10530          CDS       T00010                                 

Symbol
ntdC
Name
(RefSeq) NTD biosynthesis operon putative oxidoreductase NtdC
  KO
K18652  glucose-6-phosphate 3-dehydrogenase [EC:1.1.1.361]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various antibiotics
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00877  Kanosamine biosynthesis, glucose 6-phosphate => kanosamine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    BSU10530 (ntdC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.361  glucose-6-phosphate 3-dehydrogenase
     BSU10530 (ntdC)
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA PglD_N F420_oxidored OCD_Mu_crystall 2-Hacid_dh_C CoA_binding Shikimate_DH Rossmann-like Ldh_1_N Chitin_synth_1N
Other DBs
NCBI-GeneID: 936337
NCBI-ProteinID: NP_388934
Pasteur: BG13076
BSORF: BG13076
UniProt: O07564 A0A6M4JES8
Position
complement(1126400..1127452)
AA seq 350 aa
MKKIGIIGAGGIARAHATALSTIKNAELVGVYDINQQNAESFVKTFGGKSFENVDELIDA
SEGLIVASPNFCHKEHALQALGKHKHVLCEKPMAISLEEASIMKDTAERLSVRASMGFNY
RYLSYVNILKSLIINNELGNILSIKVHFKKNSALRRKKFTWRDDANSKKTSGSLGDLGIH
LIDMVWYLFESDFITESVRAKMNTNVKTKEDKQVLVDDYAEIYGQLKNKVFVNIITSKCS
VPEDCGFSIEVVGHKKEFKYHTGNPHVYKLIDGLNVVDCPVPQSLLNDPPNEFYGWADSF
RSELINWIASTQNDWVEIPSFSDGFRSQEVLEMFFEKDSNSQPMSVSAVN
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaagaagataggcatcataggtgcaggtggtattgcaagagcgcatgcaactgcttta
tctacaataaaaaatgcagagttagtaggggtatatgacataaatcaacaaaatgcggaa
agctttgtgaaaactttcggcgggaagtcatttgaaaacgtagatgaactaattgatgcc
tcagaaggtttaattgtagcatcaccaaacttttgccataaagaacatgctttgcaagca
ttaggaaaacataagcatgtattatgtgaaaagcctatggctatttctcttgaagaagca
agcataatgaaagatactgctgaaaggttgagcgtaagagccagtatgggatttaattat
agatatttatcttacgtaaatatcttaaaaagcttaattatcaataatgaactaggtaac
atactgtccataaaagtacacttcaagaaaaatagtgcacttagacgtaagaagtttact
tggagagatgacgctaatagtaagaagacgagtggatcattgggggatctgggtattcac
cttattgacatggtatggtatttgttcgagagtgatttcatcacagaatcagtaagggca
aagatgaacacaaatgtaaaaacaaaagaggataaacaggtacttgtagatgactatgca
gaaatttatggccagctgaagaacaaggtatttgtaaatatcatcacatcaaagtgttct
gtacctgaagactgtggttttagcattgaggtagttggacacaaaaaagagtttaaatac
cacacaggtaatcctcacgtttacaagctcatagatggcttgaacgtggtagactgccca
gtaccgcaaagcctattaaacgatccgccaaacgagttttatggatgggctgattctttt
agaagcgagttaatcaattggattgcatcaactcagaatgattgggttgagatcccttct
tttagtgatggttttagatctcaggaagtattagaaatgttctttgagaaagacagcaac
tctcaacccatgtctgtttcagcagtcaactag

DBGET integrated database retrieval system