KEGG   Bacillus subtilis subsp. subtilis 168: BSU10540Help
Entry
BSU10540          CDS       T00010                                 

Gene name
ntdB
Definition
(RefSeq) NTD biosynthesis operon putative hydrolase NtdB
  KO
K18654  kanosamine-6-phosphate phosphatase [EC:3.1.3.92]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of secondary metabolites - other antibiotics
bsu01100  Metabolic pathways
Module
bsu_M00877  Kanosamine biosynthesis, glucose 6-phosphate => kanosamine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    BSU10540 (ntdB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.92  kanosamine-6-phosphate phosphatase
     BSU10540 (ntdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S6PP Hydrolase_3 Hydrolase HAD_2 Ufm1
Motif
Other DBs
NCBI-GeneID: 939323
NCBI-ProteinID: NP_388935
Pasteur: BG13077
BSORF: BG13077
UniProt: O07565
Structure
PDB: 

Position
complement(1127466..1128314)
Genome map
AA seq 282 aa AA seqDB search
MLLSKKSEYKTLSTVEHPQYIVFCDFDETYFPHTIDEQKQQDIYELEDYLEQKSKDGELI
IGWVTGSSIESILDKMGRGKFRYFPHFIASDLGTEITYFSEHNFGQQDNKWNSRINEGFS
KEKVEKLVKQLHENHNILLNPQTQLGKSRYKHNFYYQEQDEINDKKNLLAIEKICEEYGV
SVNINRCNPLAGDPEDSYDVDFIPIGTGKNEIVTFMLEKYNLNTERAIAFGDSGNDVRML
QTVGNGYLLKNATQEAKNLHNLITDSEYSKGITNTLKKLIGS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttattaagcaagaaatcggagtataaaacgttatccacggttgaacatcctcaatat
attgttttttgtgattttgatgaaacgtattttccgcatacaatcgacgaacaaaagcaa
caagacatctatgaactcgaagactatctagaacaaaaaagtaaagatggggagctaata
atcggatgggttactgggagcagtatagaatctattctcgataaaatgggacgaggaaaa
tttagatattttccgcattttatagctagtgatcttggaactgaaattacgtacttttca
gagcataacttcggtcagcaagataacaagtggaacagtcgcataaatgaagggtttagt
aaagaaaaggttgaaaaacttgtgaaacagctgcatgaaaatcataacattcttttgaat
cctcaaacccaattaggaaagtcacggtataagcataacttctactatcaggaacaagat
gaaataaacgacaagaaaaacctattagctattgaaaaaatctgcgaagaatacggcgtt
tcagtaaatataaatcggtgtaatcccttagcaggcgatccagaagacagctatgatgta
gattttatccccatagggacaggaaagaatgaaattgtaacgtttatgttagagaaatac
aacctaaataccgaaagagctatcgcatttggggatagtggaaatgatgttcgtatgtta
cagacagtagggaatggatatctgctaaaaaatgcaacacaggaagccaaaaacttgcac
aaccttataactgatagtgagtactcaaaaggaattactaataccttaaaaaaattaatt
ggatcatga

DBGET integrated database retrieval system