KEGG   Bacillus subtilis subsp. subtilis 168: BSU10570
Entry
BSU10570          CDS       T00010                                 

Symbol
yhjN
Name
(RefSeq) hypothetical protein
  KO
K07120  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU10570 (yhjN)
SSDB
Motif
Pfam: AbrB
Other DBs
NCBI-GeneID: 939324
NCBI-ProteinID: NP_388938
Pasteur: BG13080
BSORF: BG13080
UniProt: O07568 A0A6M4JGP4
Position
complement(1130918..1132072)
AA seq 384 aa
MKKDENLLKDLWFIAISAAGGFILSLTGISIGWMIGTLIVACCLAMIRPAWLMMAPDQKG
INRRWLALGQMILGIELGQKLNLSVLSVLKDHWFSVGVMLILSILLAMLSGYVLWRFSKT
DMMTSFVGTAPGGLSAMPSIAQEVGANTAIVSLVQMMRVLLVVLSIPFLVILIYTKQDRT
ASAAAETISSATTDFRLAPVLWTVILILAAWGACKAAKFLKFPAPWLLGSMLGVAIVHVG
GAAVTGHDMTAWWLSQANHVSQVFLGATIGSKMYKSMFAGVTRIIIVGFVSSVGLIAAMF
LSAVIVSELTGISLITSVLAFAPGGIAEMATTSVTLHADSTFVVAVQVIRVILVIALLPP
FYRLLHHLHGEKKDKKSSISGSSA
NT seq 1155 nt   +upstreamnt  +downstreamnt
ttgaagaaagacgaaaatctcctcaaagatctatggtttatcgcaatcagtgcagccggg
gggtttattctttcattaaccggaatatcaattggatggatgatcggaacactgattgtc
gcctgctgcctcgccatgatacggccggcatggctgatgatggcaccagaccaaaaagga
attaaccgacgatggctcgccctcgggcagatgatcctcggcatcgaattgggccaaaag
ctgaatttatccgttctctctgttctcaaagaccattggttttcagtcggcgttatgctg
atattgtctatcctgctggccatgctgtcaggatatgtgctttggcgtttcagcaaaacg
gatatgatgactagctttgtcggcaccgctcccggcggactttccgccatgccgagcatc
gcacaggaagtaggcgccaataccgctatagtcagcctcgttcaaatgatgcgtgtgctg
ctcgtggtgctttccattccgtttttagtcattctgatctatacaaaacaagatcgtacc
gcaagtgccgcagcagagacgatttcttctgcaacgacagattttaggctcgctcccgtt
ttgtggaccgtcattcttattctcgctgcctggggagcttgcaaagctgcgaaattttta
aaatttccagctccatggctgctcggcagcatgctcggtgtagcaattgtacatgttggc
ggagctgcggtgacagggcacgacatgacggcatggtggttgtcacaagctaaccatgta
tcacaagtatttctcggggcaacgatcggctctaagatgtacaaaagcatgtttgccggc
gtcacccgtattatcatcgtcgggtttgtctcgtccgtcggtttaatcgcagcaatgttt
ttgagcgccgtgatcgtttccgagctgacaggaatttcgctcatcacttctgttctggca
tttgcgcccggcgggattgcagagatggcgacgacgtcagttaccttacatgctgattcc
acctttgtcgttgcggttcaggtcattcgcgtcattctggttattgccctgctgccgccg
ttttatcgcctgcttcaccatcttcatggtgaaaaaaaagacaaaaagagctcaatcagc
ggcagtagtgcctag

DBGET integrated database retrieval system