KEGG   Bacillus subtilis subsp. subtilis 168: BSU10580Help
Entry
BSU10580          CDS       T00010                                 

Gene name
yhjO
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 939780
NCBI-ProteinID: NP_388939
Pasteur: BG13081
BSORF: BG13081
UniProt: O07569
Position
complement(1132179..1133384)
Genome map
AA seq 401 aa AA seqDB search
MLTSFHSIKSRYTAPVRLRFFGELLTSLTGAMMGPFMVLYLHEQLNGSIMMPMLIISLQP
FADIFLTLAAGRVTDRLGRRTAILTALLLQSAAMTGFVFAEHAYVFAILYVMNGIGRSLY
IPASRAQIAESTPESRRSEVFAVINAIYSTGLTAGPLVGMLLYNHNPVWIFALDAAALFI
YFLIAALKLPETKPLHPAVTPKMSASFTIYRPVLLLLLLSLPISMLYAQTETTYRLFSKN
MFSDYLSMLTIYSAAKALFSCVLQVPLVKGTEKLSMKTILFITYICYSLAAAGFACSTSL
TMLLVTAAVMTVGESIGLTHIQTFISKLAPPHLLGRFYAVYGLHWDISRSIGPLAGGLIL
TSFGGEVIFYALAVCLLTAGLSLTYTIEKLEHKVIRKVNRL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagttttcactctataaaatcgagatataccgctcccgttcggctccgcttt
ttcggcgaattgctgacaagcctgacaggtgcaatgatgggaccttttatggtgctgtat
ctgcatgaacaattaaacggcagtatcatgatgccaatgctgatcatcagccttcagcca
tttgctgatattttcctgacgctcgctgcaggacgggtgacggatcggcttgggcggcgc
acagcgattttgaccgcattgcttcttcaatcagcggcaatgacagggtttgtatttgct
gagcatgcgtatgttttcgctattctctatgtcatgaatggcatcggaagatcgttgtac
attcccgcttcccgcgcccaaatcgctgaaagcacgccggaaagcagacgttcggaagtg
tttgcggtcatcaatgcgatctattcgacgggtctgacggcaggaccgctagtggggatg
ctgctgtacaatcataaccccgtgtggatattcgcattagatgctgcagcattgtttatc
tactttctgatcgctgcactgaaactgcctgagacaaagccgctacacccagctgttacc
ccgaaaatgtccgcgagctttacaatatacaggcctgtcctgcttcttttgctgctttct
ctccccatcagcatgttatatgcacaaacagaaacaacatacaggctgttcagcaaaaac
atgttttctgattatctgtccatgctgaccatctattcagcagcaaaagctttattcagc
tgtgttctccaagtacctcttgtcaaagggaccgaaaagctttcaatgaaaacgatcctc
ttcattacttatatttgctactcccttgcggcagccggctttgcatgctcaacctctctg
acaatgcttttagtgacggcagcggtgatgacggttggtgaaagcatcgggctaacccac
atccagaccttcatatcgaaattggcgccgcctcatttgctgggccggttttatgctgtc
tatggtctgcattgggatatatcccgctcaatcggaccgctggcaggcgggctgatcctg
acatcatttggcggagaagtgattttttacgctcttgccgtgtgtctgctgacagcgggt
ttatctctgacttacacaatagaaaagctcgaacacaaggtcataagaaaagtgaatcgc
ttatag

DBGET integrated database retrieval system