KEGG   Bacillus subtilis subsp. subtilis 168: BSU10590
Entry
BSU10590          CDS       T00010                                 

Symbol
yhjP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SBP_bac_5 SgrR_N MarR
Other DBs
NCBI-GeneID: 936342
NCBI-ProteinID: NP_388940
Pasteur: BG13082
BSORF: BG13082
UniProt: O07570 A0A6M4JF10
Position
1133498..1135225
AA seq 575 aa
MKLIEHYVALVKTGCAEYGQMNEMTLTEIADCLFCTERNAKLILHKLENSNWIIRESGAG
RGRKSKIAFLRRPEELLLQTAKEYTMSGKLKKAKELLQQYQSAFPGLQNEYNMWLSEVFG
FVTETGENGAKDVLRLFITPESVSSLDPCQIFLRSEGHFVKQIFDTLFTFDSDMQEPKPH
LVHGWEEVGKKQWRFFLRKGVLFHNGQPLTSRDVAFTFQRFLELADNPYKWLLHGVKQVL
EKGPYCVELILDKPNALLPYALCDERLSILPAEQGGGKNGTGPFQMNQQHSGMLVLEANE
RYFKGRPYLDRVEFVFSEQAGEMNGFTIQEKQTCPEQQTVFDERHVQYLSLNLKKKGPLQ
HRSFRKALRLLISSERLVREAGGHRRIPVTSFLHPSPFEWEGVSPSELLKKSGYEGETIV
LYTFSETDHREDAEWIQNICAQHGIRLTLQFCDAADLRRPEIVQMADIIHDSATFYQDSE
FGFLHLLLSENSFLYQHLSEKLTQICSGMTERMFSMPDRCSRINILRDIDRQMIQELNAI
PLYQNVLQVTSSKNVKGLVLDEEGWIDLYSVWLSK
NT seq 1728 nt   +upstreamnt  +downstreamnt
ttgaagctgatagagcactacgtggcgcttgtaaaaacaggctgcgccgagtatgggcaa
atgaacgaaatgacgctcactgagattgccgactgtttattttgtacagaaagaaatgca
aagctcattttacataagctggagaacagcaattggattatccgggaaagcggggcgggg
cgcggccgcaaatctaaaatcgcgtttcttcggaggcctgaggaactgcttcttcaaact
gcaaaggaatataccatgtcaggaaagcttaaaaaggcaaaggagctgcttcagcagtat
cagtccgcgtttccagggcttcaaaacgaatataacatgtggctatcagaggtattcgga
tttgtgacggagacaggcgagaatggggcgaaggatgtcctgcggctgttcatcacgcct
gaatctgtcagcagtttggatccatgccaaatatttttgcggtctgagggccatttcgtc
aaacagatatttgatacactcttcacgtttgattcggatatgcaggagccgaagcctcat
ttggttcatggatgggaagaggtcggaaaaaaacaatggagattttttcttcgaaaaggt
gtgttatttcataatggacagccgctgacatcgcgggacgttgcgtttacatttcagcgc
tttttggaactggctgacaacccgtataaatggcttctgcacggagtgaaacaagtctta
gaaaagggcccttattgtgtggagctcatactcgataagccgaatgcgcttttgccgtat
gctctttgtgatgaacggctgtccatactgccggcagaacagggcggcgggaaaaatgga
acagggccttttcagatgaatcagcaacatagcgggatgcttgtgcttgaagccaatgag
cgctacttcaagggacgcccctatttggatcgcgttgagtttgtgttttctgagcaagcc
ggagagatgaacggttttaccattcaagaaaaacaaacatgtcctgagcagcaaactgtc
tttgatgagcggcatgttcagtatttgtcgcttaatctgaaaaagaaggggcctcttcag
caccgaagctttagaaaagcgctccggctgctgatttcctctgaacggctcgttcgtgaa
gcgggagggcaccgaagaattccggttacgtcctttttgcatccgagtccttttgagtgg
gagggcgtttcgccatctgaattgttgaaaaaaagcggatacgagggcgaaacaatcgtg
ctttataccttttcggaaacggatcatcgtgaggacgccgaatggattcaaaatatttgc
gcccagcacggtatcaggcttacacttcaattctgtgatgctgctgatctgcgacggccg
gaaatcgtgcagatggcggatatcattcatgacagtgcgacgttttatcaagacagcgag
tttggttttctgcatttgctgctgtcggagaacagtttcttgtatcagcatctatctgaa
aagctgacacagatttgctcaggaatgacagagcggatgttttccatgcctgaccgctgt
tcgagaatcaacatcctgcgtgacattgaccggcagatgatacaggagctgaacgcgatc
ccgctgtatcaaaatgtgctccaggtgacatcaagtaaaaatgtaaaaggcctggtgctt
gatgaagagggatggattgatttgtactccgtatggctgtccaaataa

DBGET integrated database retrieval system