KEGG   Bacillus subtilis subsp. subtilis 168: BSU10600
Entry
BSU10600          CDS       T00010                                 

Symbol
yhjQ
Name
(RefSeq) cysteine-rich protein YhjQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF326
Other DBs
NCBI-GeneID: 939779
NCBI-ProteinID: NP_388941
Pasteur: BG13083
BSORF: BG13083
UniProt: O07571 A0A6M3Z9R8
Structure
PDB: 
5FIG

Position
complement(1135255..1135581)
AA seq 108 aa
MEQYSEACIEACIDCMKACNHCFTKCLEESVQHHLSGCIRLDRECADICALAVKAMQTDS
PFMKEICALCADICEACGTECGKHDHDHCQACAKACFTCAEQCRSMAA
NT seq 327 nt   +upstreamnt  +downstreamnt
atggagcaatattctgaggcttgtattgaggcttgcatcgattgcatgaaggcttgcaat
cattgtttcactaaatgcttggaagaaagcgtgcagcatcatctcagcggatgcatccgg
cttgacagggaatgcgcggatatttgcgcgctggcggtcaaagccatgcaaacggacagc
ccgtttatgaaagaaatttgtgcactttgcgccgatatttgtgaagcatgcggcactgaa
tgcggaaagcacgatcatgatcattgccaagcatgtgcgaaagcctgcttcacctgtgct
gaacaatgccgcagcatggcagcgtaa

DBGET integrated database retrieval system