KEGG   Bacillus subtilis subsp. subtilis 168: BSU10610
Entry
BSU10610          CDS       T00010                                 

Gene name
yhjR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rubrerythrin DUF2383 Ferritin_2 COQ7 Ribonuc_red_sm
Other DBs
NCBI-GeneID: 939352
NCBI-ProteinID: NP_388942
Pasteur: BG13084
BSORF: BG13084
UniProt: O07572 A0A6M3Z9M4
Position
complement(1135699..1136136)
AA seq 145 aa
MHYSYYPYPVPYREDPVLIRNLQKAINGEFSAIQCYRKLAELAHSDEVRKQIEEIRRDEI
RHLREFSTLYGSITGKHIMPKQTEECPDNFTRGLDAAFKDEQETVDFYLRAAEETSNLKA
KGVFTRAARDEQNHAVWFLYYLMER
NT seq 438 nt   +upstreamnt  +downstreamnt
ttgcattacagctactatccctatccggtgccataccgggaagatcctgttttgattcgg
aatttgcagaaggccatcaacggagaattcagtgctattcaatgctaccgcaagcttgcc
gaactcgcccacagcgatgaggtcagaaaacagattgaagaaatcaggcgtgacgagatt
cgccacctccgtgaattttccacactgtatggttcaattaccggcaaacacatcatgccg
aaacaaacggaagaatgcccggacaatttcacaagaggactggacgccgcttttaaagat
gaacaagaaaccgtcgacttttacttgcgtgcggccgaggaaacgtcaaacttaaaagcg
aaaggcgtctttacgcgcgcagcacgtgatgaacaaaatcacgctgtctggttcctatac
tatctgatggaacgttag

DBGET integrated database retrieval system