KEGG   Bacillus subtilis subsp. subtilis 168: BSU10620
Entry
BSU10620          CDS       T00010                                 

Symbol
addB
Name
(RefSeq) ATP-dependent helicase/deoxyribonuclease subunit B
  KO
K16899  ATP-dependent helicase/nuclease subunit B [EC:5.6.2.4 3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU10620 (addB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU10620 (addB)
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU10620 (addB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AddAB pathway proteins
     BSU10620 (addB)
SSDB
Motif
Pfam: PDDEXK_1 UvrD_C Phage_lysozyme2
Other DBs
NCBI-GeneID: 936341
NCBI-ProteinID: NP_388943
Pasteur: BG10465
BSORF: BG10465
UniProt: P23477 A0A6M4JEP0
Structure
Position
1136320..1139820
AA seq 1166 aa
MGAEFLVGRSGSGKTKLIINSIQDELRRAPFGKPIIFLVPDQMTFLMEYELAKTPDMGGM
IRAQVFSFSRLAWRVLQHTGGMSRPFLTSTGVQMLLRKLIEEHKQEFKVYQKASDKSGFT
AQVERMLTEFKRYCLEPEDIRRMAESGTASEYRGERVLSEKLHDLSILYQQMEKSLADQY
LHSEDYLTLLAEHIPLAEDIKGAHIYVDGFYQFTPQEFRVLEQLMVHAEHITFSLTADKP
SYEREPHELELFRMTGKTYYRLHQKAKELNLDITYKELSGTERHTKTPELAHLEAQYEAR
PAIPYAEKQEALTVMQAANRRAELEGIAREIHALVREKGYRYKDVAILARQPEDYKDMVK
EVFADYEIPYFIDGKASMLNHPLIEFIRSSLDVLKGNWRYEAVFRCVKTELLFPLNEPKA
KVREQVDQLENYCIAYGIKGDRWTKGDRFQYRRFVSLDDDFAQTDQEIEMENMLNDTRDW
IVPPLFQLQKRMKKAKTVQEKAEALYRYLEETDVPLKLDQERQRAEDDGRIIEAQQHQQA
WDAVIQLLEEFVEMMGDDEISLDLFQQMIEAGAESLTFSLIPPALDQVFVGNMDLSRMYG
TSCTFVLGANDGVLPARPDENGVLSDDDREWLKTIGVELSSGGRERLLDEHFLIYMAFSS
PSDRLYVSYPIADAEGKTLLPSMIVKRLEELFPHHKERLLTNEPEQVSDEEQLMYVVNKS
VAQSFTASQLRLWTREYDISDVWWSTYNVLMSEQDRLQSKKLFSSLFFRNEVKQLERSVS
RQLYGERIQGSVSRMETFNACPFSHFASHGLHLKERQFFKLEAPDIGQLFHSSLKLISDR
LREQKLDWRDLTKEQCELFSYDAVERLAPKLQKEILLSSNRHYYVKEKLQKIVTRVSGIL
SEHAKASGFVPIGLELGFGGKGPLPPLTFQLKNGCTMELVGRIDRVDKAESSKGLLLRIV
DYKSSDKGLDLAEVYYGLALQMLTYLDLSITHSADWLGMRATPAGVLYFHIHDPMIQSNL
PLGLDEIEQEIFKKFKMKGLLLGDQEVVRLMDTTLQEGRSNIINAGLKKDGSLRSDSAAV
GEKEFDLLTKHVRRTFQEAGEQITDGRVSIEPYKMKNKTPCTYCAFKSVCQFDESLEENE
YRPLKAEKDKTILEWIKKEADGNEHS
NT seq 3501 nt   +upstreamnt  +downstreamnt
ttgggagcagagtttttagtaggcaggtccgggagtggaaaaacgaagctgatcatcaac
agcattcaggatgaattgcgccgggctccattcgggaagccgatcatttttctagtcccg
gatcaaatgacgtttttaatggaatacgagcttgctaaaacgccagatatgggcgggatg
atacgcgctcaagtgttcagtttttcacgattggcctggcgcgtcctccagcatacggga
ggaatgagcaggccgtttctgacgagcaccggcgtacaaatgctcctgcggaagctcatt
gaggagcataaacaggagttcaaagtctatcaaaaagcgagtgacaaaagcgggtttacc
gcacaggttgagcggatgctgacagagtttaagcgctattgtctggaaccggaggatatc
cgccggatggcggaaagcggaacggcttccgagtatcgcggagaacgtgttttatctgaa
aagctccatgacttatcaattctgtatcagcaaatggaaaaaagcctcgcagatcaatat
cttcactctgaggattatttgacattgctggcagagcatatcccgcttgcggaagatata
aaaggcgcccatatctatgtggatggcttttatcagtttaccccgcaggaattcagggtg
ttggagcagcttatggttcatgcggagcatatcacgttttcgctcacagcggacaagccg
tcatatgagcgggagccgcatgaactggaattgttcagaatgacggggaaaacctattac
cgcctgcatcagaaggcgaaggaactgaatttggacattacgtataaagagctgagcggg
actgagcggcatacaaagacgccggaattggcgcatctagaggcacagtatgaagcgcgt
ccggccattccatacgcagaaaaacaagaagcccttactgtgatgcaggccgcaaacaga
cgagctgagctggaaggcattgctcgggaaattcacgccctagtcagagagaagggatat
cgctataaggatgtagcaattcttgcgcgccagccggaagactacaaggatatggtgaag
gaagttttcgcagattacgagattccttatttcattgacggaaaagcatctatgctgaac
catccgttaattgaatttatccggtcgagccttgatgttctgaaagggaattggcgttat
gaagcggtgtttcgctgcgtgaaaaccgaactgctattcccgctcaatgaaccgaaggcc
aaagtgagagaacaggtcgatcagctcgaaaattactgtatcgcctatggtattaaaggc
gaccgctggacaaagggcgatcggttccaatacaggcgttttgtgtcattggatgatgat
tttgcgcagactgatcaggaaatcgaaatggaaaacatgttgaatgacacccgcgattgg
attgttccgccgctttttcagcttcaaaaacgcatgaaaaaagcgaagacggttcaagag
aaggcggaggcgctctatcgttatttagaagagacggatgtgccgctgaagctggatcag
gaaaggcagcgtgctgaggatgacggcagaatcattgaagcgcagcagcatcagcaggcg
tgggacgcagtcattcagctgcttgaggagtttgttgaaatgatgggagatgatgagatt
tctcttgatttgtttcagcaaatgatagaagccggcgcggagtcgcttacattttctcta
attccgcctgcgcttgaccaggtgtttgtcggcaatatggatttgtccagaatgtatggc
acctcctgcacctttgtgctcggggcaaacgacggcgttctgccggcacgccctgatgaa
aacggggtcctgtcggatgatgaccgggaatggctgaaaacgattggggttgagctatcc
tcaggcggacgagagcgtttgcttgatgagcacttcctcatctacatggcgttttcaagt
ccgtctgaccggctttacgtatcgtatccgattgctgatgcggaaggaaaaacgcttttg
ccgtcgatgatcgttaagcggctggaagaactgtttccgcatcataaggagcgcctgtta
acaaatgaacctgaacaggtcagcgatgaggaacagctgatgtatgttgtgaataaaagc
gtggcacagtcctttaccgcgagccagctcaggttatggactcgggaatacgacatcagc
gacgtctggtggagcacgtacaatgtgctgatgagtgagcaggacaggctgcaatcgaaa
aagctgttctcaagcctgtttttccggaatgaagtgaagcagcttgaacgcagcgtgtcg
agacagctctatggtgaacgtattcagggcagtgtatcgagaatggaaacctttaacgca
tgcccgttttcccattttgcgtcacacgggctgcatttgaaggaacggcaattcttcaag
cttgaagcaccggatatcggccagctgtttcattccagcttaaagctgatttcggacagg
ctgcgtgagcaaaagctggattggcgcgatttaacgaaggagcagtgcgagctgttttcc
tatgatgcggtagagcggctggcaccgaaactgcaaaaggaaattctgctcagctcaaac
cggcattattatgtgaaggaaaaactgcaaaaaattgtgacacgtgtgtccggcatttta
agcgagcatgcgaaagcgagcggattcgtaccgatcgggcttgaactgggctttggagga
aaagggccgcttccgccgctgacctttcaactgaaaaacggctgtacgatggaactcgtc
gggcgaattgaccgtgttgataaggctgaaagctcaaaaggcctgctcctcaggattgtc
gattataaatcaagcgacaaaggccttgacttagcggaagtatattacggattggcactg
caaatgctgacgtaccttgatttatcgattacacattcagctgactggctcgggatgagg
gcgacgcctgccggagtgctgtatttccatattcatgacccgatgattcaatctaatctc
ccgcttgggcttgacgagattgaacaggagatctttaagaaatttaaaatgaagggcttg
ctcctcggtgatcaggaagtggttcgcctcatggatacaacccttcaagagggacgttca
aatatcataaacgccggcttgaaaaaagacggctctctcagatcagactcagcagcagtc
ggtgaaaaggaatttgatcttttgacaaagcatgtgcgccgcaccttccaagaagcgggc
gaacaaatcaccgacgggcgcgtatccattgagccgtacaaaatgaagaacaagacgccg
tgcacatactgtgcgttcaaatcagtatgccaatttgatgaatcactggaagaaaacgag
tatcgcccattaaaggctgaaaaggacaagacaatacttgagtggataaaaaaggaggcg
gatggcaatgaacattcctaa

DBGET integrated database retrieval system