KEGG   Bacillus subtilis subsp. subtilis 168: BSU10640
Entry
BSU10640          CDS       T00010                                 

Symbol
sbcD
Name
(RefSeq) nuclease SbcCD subunit D
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU10640 (sbcD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU10640 (sbcD)
SSDB
Motif
Pfam: Metallophos Metallophos_2 SbcD_C
Other DBs
NCBI-GeneID: 936351
NCBI-ProteinID: NP_388945
Pasteur: BG10467
BSORF: BG10467
UniProt: P23479 A0A6M4JET8
Position
1143577..1144752
AA seq 391 aa
MRILHTADWHLGKTLEGRSRLSEQADVLDELNTIVKDEQIDAIVMAGDAFDTVNPPALAE
QLFYESLSALSDRGKRPIVVIAGNHDNPDRLSAASPLTHENGIHLIGYPTTEPIHIEVPS
AGELLAVGALAYPSEARLNEVLSDTFDEKLLRDHYDVKIRQAFEHMTSRFRTDAVKIAAS
HIYVAGGNQTDSERPIEVGGAYTVAAESLPADAAYVALGHLHRPQTIKRARTLARYSGSP
LAYSFSEAGYAKSVTIVDAKPGEEATWQEVLLSSGKPLVKWKAANGLSEVYSWLDEGRDQ
NAWIDLEIRVADQLSLEEIHRLRKAHPGFIHIRPVFEEQNKDRERIEVKHVSIEDRFKKF
YEKQTGGAVPDEEMVKLFLELASGVEEEDAK
NT seq 1176 nt   +upstreamnt  +downstreamnt
ttgcggattttacatacggctgactggcatcttggaaaaacgcttgaaggaagaagcagg
ctgagtgaacaggccgatgtgctggatgaactgaatacgattgtaaaggatgagcagatc
gatgccattgtaatggcgggggatgcatttgacaccgtaaacccgccagctttagccgag
cagctgttttatgaaagcctgtctgcgcttagcgacagaggaaagcgcccgatcgtcgtc
attgccggaaatcacgataatcctgaccgtttgtccgccgcttcaccgctgacacatgaa
aacggcattcatttaatcggttatccgacaacagagccgattcatattgaagtgccttca
gcaggagagcttttggcggttggagcgctggcgtacccatctgaagcgcggttaaatgaa
gtgctatccgatacgtttgatgaaaagctgctccgtgatcactatgatgtgaaaatcagg
caggcgtttgagcatatgacaagccggttccggaccgatgcagtgaagattgccgccagc
catatttatgtggcaggcggaaaccaaaccgattcagagcggccgattgaagtcggcggt
gcatacacggtggctgctgaaagcctgccggcagatgccgcttacgttgcgctcggccat
ttgcatcgcccgcaaacgatcaagcgggcgcggacgcttgcgcgttattcaggatctccg
ctcgcctacagcttttctgaagcgggctacgctaaatcagtgacgattgtggacgcaaag
cctggggaagaggccacttggcaagaggtgttattatcaagcggcaagccacttgtgaag
tggaaagcggcaaatggattaagtgaggtgtacagctggctggatgaaggcagagatcag
aatgcttggattgacttggaaatccgtgtcgcggaccagctgtcacttgaagagattcac
aggctgcggaaggcgcacccgggctttatccatatcaggccggtttttgaagaacagaac
aaagaccgggaacggatcgaggttaaacatgtctcaatcgaggaccgctttaagaaattt
tatgaaaaacaaactggcggtgcggtgccggatgaagaaatggtgaagctgtttttagag
cttgcatcaggcgttgaagaggaggatgcgaaatga

DBGET integrated database retrieval system