KEGG   Bacillus subtilis subsp. subtilis 168: BSU10650
Entry
BSU10650          CDS       T00010                                 

Symbol
sbcC
Name
(RefSeq) nuclease SbcCD subunit C
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU10650 (sbcC)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU10650 (sbcC)
    Archaeal homologous recombinant proteins
     BSU10650 (sbcC)
SSDB
Motif
Pfam: AAA_23 SbcC_Walker_B AAA_29 AAA_15 SMC_N ABC_tran AAA_21 zf-RRN7 Exotox-A_target MMR_HSR1
Other DBs
NCBI-GeneID: 939784
NCBI-ProteinID: NP_388946
Pasteur: BG13088
BSORF: BG13088
UniProt: O06714 A0A6M4JGT2
Position
1144749..1148141
AA seq 1130 aa
MKPIALSIKGLHSFREEQTIDFEGLSGAGVFGIFGPTGSGKSSILDAMTLALYGKVERAA
NNTHGILNHAEDTLSVSFTFALQTNHQISYKVERVFKRTDEMKVKTALCRFIEIKDEHTV
LADKASEVNKRVEELLGLTIDDFTRAVVLPQGKFAEFLSLKGAERRHMLQRLFNLEQYGD
RLVKKLRRQAQEANARKNEMLAEQSGLGEASSEAVEQAEKVLEQAEARLEAMRKNRDQAK
ERFTEHQEIWNVQKEKSTYEEEEKRLAEEQPHIDSMQKRLLEAETAAALKPYADRYAEAI
QHEEQAEKEQTLAQKDLADRTAFFQQKHEEYEAWRQHKSEKEPELLAKQEQLSRLQEIEI
KLSEAKQEEERKKADLRQKEEALQSVMNELETVTDRLTRGQNRQTELKQQLKSLQVTSDE
RKSCQQAAEMALRIRQTEEQIKKEKKRSEELNLVLQKMNEEKNTLVQKTEAEENNIIQAY
EAVQTVYHLVCETERSLTRMTEEARKSQHTLHLQREKARVALLTKELAQKLTAGKPCPVC
GSTDHDPSASVHETYEADSHLEEDIKRTDVLLTEAAALSQEILSAKIMLEEQSARFIEQC
PFLQTIQAQNLEAAASFEHQPVYEAFETAKFEWKRIKQDILSVKTRMAQMIGAYQESLKK
AEQLNEKIGFEKREADRIESIISELQSSMDSSLNMFKEAFQNQSVDEAEKWQQAIEEKDR
AAEECEKRIEKSIAFLAEHEAQKEKLRESGHRLEREKLELHYAAERIKSVIADYEHELGD
YAKGDSIQIKLRSVQQDLKLLKEKEQSLYEELQSAQMKLNQAKSRASASELTLQEAKGRL
EKAKAAWLEHTKNTSITRTEEVEQSLIPADELEKMKTGIDQFMDKLKQNAANLKRVAEIL
AGRALSESEWNETVAALQEAEDAFGAAIEEKGAAAKALAVIRDHHKRFNEIEAELKKWQM
HIDRLDKLQAVFKGNTFVEFLAEEQLESVARDASARLSMLTRQRYAIEVDSEGGFVMRDD
ANGGVRRPVSSLSGGETFLTSLSLALALSAQIQLRGEYPLQFFFLDEGFGTLDQDLLDTV
VTALEKLQSDNLAVGVISHVQELRARLPKKLIVHPAEPSGRGTRVSLELM
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgaagccgatcgccttaagcattaaggggctccacagctttagagaggagcagacgata
gattttgaaggcctttccggtgccggtgttttcggcattttcggcccgacaggaagcggt
aaatcctctatactcgacgcaatgacgcttgctttatacggaaaggtggaacgggcggcg
aataatacgcacggaatcttaaatcacgccgaagatacgctgtctgtgtcctttaccttt
gcgcttcagacgaatcaccaaatctcatacaaagtcgagcgtgtgtttaagagaacggat
gaaatgaaggtaaaaacggcactttgccgcttcatcgaaatcaaggacgagcatacggtg
ctggctgataaagccagcgaagtgaataaaagagtggaggagctcttagggctgacgatc
gacgattttacgagagcggtggtgctgccccaagggaaatttgctgaatttctgtcttta
aaaggggcagagcgcaggcatatgcttcagcgtttatttaatttggagcaatatggagac
aggcttgtgaaaaagctgagacggcaggcgcaggaagccaatgcgagaaaaaatgaaatg
cttgctgaacagtccggtctcggtgaggcgagctcagaggcagtggagcaggctgaaaag
gttctcgaacaagctgaagcccggctggaagcgatgaggaagaaccgtgatcaggcgaag
gagcggtttacagagcatcaggagatatggaatgtccaaaaggaaaaatccacttatgaa
gaagaggaaaaacgtctcgcagaagaacagccgcatatagacagcatgcaaaaacgcctg
ctggaagcagaaacagcagcagcccttaagccctatgcggaccggtacgcagaagcgatc
cagcatgaggagcaagctgaaaaggaacaaacgctagcccaaaaggatttagcagaccgg
acagctttctttcagcaaaaacatgaagagtatgaagcgtggcgccagcataaaagcgag
aaagagcctgagcttttagccaaacaggaacagctttcacgcttgcaggaaatcgaaatc
aaactgagtgaggccaagcaagaggaagagcgcaaaaaggctgacctccggcagaaagaa
gaggctcttcaatctgtcatgaatgaattagagaccgtaacagaccgcctgacacgaggg
caaaacagacagacagaattgaagcagcagctcaaatccctgcaggtgacatccgatgag
cgaaaaagctgccagcaggccgcagagatggcattgcgcatcagacaaaccgaggaacaa
atcaaaaaagagaaaaaacgaagtgaagaattgaacctcgtgctgcagaagatgaatgaa
gagaagaatacactcgttcaaaagacggaagcggaagaaaacaacatcattcaggcatat
gaggcagttcaaactgtgtaccatttggtgtgcgaaacggaacgctcattaacacgtatg
acggaagaggctagaaagagtcaacacacgcttcacttacagcgtgaaaaagcaagggtg
gcactgctgacaaaagagttagcccaaaagctgactgccggaaagccttgcccggtatgc
ggttcaaccgatcatgatccatctgcctcggtacatgaaacgtatgaagccgacagccat
cttgaagaggacatcaaacggacagatgtgttattgacggaagctgcagctctcagccag
gagattctttcagccaaaattatgcttgaagaacagtccgcgcgctttattgaacagtgt
ccgtttttgcagacaattcaagcacagaaccttgaagcggcagcttccttcgaacatcag
ccggtgtatgaagcatttgaaactgccaaatttgaatggaaacgaatcaagcaggacatt
ctttctgttaagacacgaatggcacaaatgattggcgcctatcaggagtctttaaaaaag
gccgagcagcttaatgaaaaaatcggttttgaaaaaagagaagccgaccgtattgaaagc
atcatcagtgagcttcaatcctcaatggacagcagtctgaacatgtttaaagaagcattt
cagaatcaatctgtggacgaagcagaaaaatggcagcaagccattgaagaaaaggaccgg
gctgcagaagaatgtgaaaaacgaattgagaagagtatcgcgtttcttgctgagcatgaa
gcacaaaaggaaaaactgcgggaatcgggacaccggcttgagcgggaaaagctggagctt
cattatgcggctgaacgcatcaagagcgtgatagctgattatgagcacgaactcggagat
tatgcaaaaggagattcgattcaaatcaaactccgctctgtccagcaggatctaaagctg
ttaaaggaaaaagaacaatctttatatgaagaactgcaaagcgcccaaatgaagctcaac
caagcgaaaagccgcgcttctgcaagcgagctcactcttcaagaggcgaagggcagattg
gaaaaagcaaaagctgcttggcttgagcatacaaaaaacacctccattacccggactgag
gaggttgaacaaagtctcatcccagctgatgaacttgaaaagatgaaaaccggcatagac
cagtttatggataaactgaagcaaaatgctgcaaacttaaaacgagtagcagagatactt
gccggcagagcattatcagagagcgaatggaacgaaaccgttgcagcattacaagaagct
gaggacgcatttggcgctgctatagaggaaaaaggcgcggccgcaaaagcactggctgtc
attcgcgaccatcataaacggtttaatgaaattgaagctgaactgaaaaaatggcagatg
catatcgacaggctggacaagctgcaagctgtgtttaaaggcaataccttcgtcgaattt
ttagctgaggagcagcttgaaagcgttgcgagggacgcctcagcaagactcagtatgctg
acaagacagcgctatgccatcgaagtagattctgagggcggcttcgtgatgcgggatgac
gcgaatggaggcgtacgacgcccggtttccagtttgtctggaggagagaccttcctcacc
tcgctttcacttgctcttgcgctgtctgcgcagattcagcttcggggggaatacccgctg
cagttctttttcttagatgaaggcttcggcacactggatcaagatctgcttgatacggtt
gtaacggccttggaaaaacttcagtcagacaacctggctgtcggtgtcatcagccatgtg
caggaactgcgtgcacggcttccgaaaaagctgatcgtccatccggctgaaccgagcggc
cgcggtacgcgggtatcacttgagttgatgtaa

DBGET integrated database retrieval system