KEGG   Bacillus subtilis subsp. subtilis 168: BSU10660
Entry
BSU10660          CDS       T00010                                 

Symbol
yisB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HNH_5 HNH
Other DBs
NCBI-GeneID: 936345
NCBI-ProteinID: NP_388947
Pasteur: BG13089
BSORF: BG13089
UniProt: O06715 A0A6M3Z968
Position
1148155..1148457
AA seq 100 aa
MAKQIAGICELCGRSDVQLTEHHLTPKEEGGTFLPTAMLCIPCHKQIHALYTNQELAVRL
NGMAELRSDPELARFVKWIRKQPPEKLIKTKKSNERKKKK
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcaaagcagattgccggaatatgtgagctgtgcggccggagcgatgtccagctgaca
gagcatcatcttacaccgaaagaggaaggcggaacgtttttgccgacagcgatgctctgt
attccttgtcataaacagattcatgccttatataccaatcaagagctcgctgtacgttta
aatggaatggctgaactcagaagcgatccagagcttgcccggtttgtcaaatggatcaga
aaacagccgcctgagaagctgatcaaaactaagaaatcaaatgaacgaaaaaagaaaaaa
tga

DBGET integrated database retrieval system