KEGG   Bacillus subtilis subsp. subtilis 168: BSU10670
Entry
BSU10670          CDS       T00010                                 

Symbol
gerPF
Name
(RefSeq) spore germination protein
  KO
K06304  spore germination protein PF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU10670 (gerPF)
SSDB
Motif
Pfam: gerPA
Other DBs
NCBI-GeneID: 939326
NCBI-ProteinID: NP_388948
Pasteur: BG13090
BSORF: BG13090
UniProt: O06716 A0A6M4JH48
Position
complement(1148494..1148721)
AA seq 75 aa
MSFMPAIVGPIAINSISGGVVNFGDSFYLSPKSSSKSALGSGAGNTGDFLLLNNAVNATN
YIDPDVNDQDMVGNG
NT seq 228 nt   +upstreamnt  +downstreamnt
gtgtcgtttatgccagcaattgtcgggcctatagctatcaattccatatcgggcggagtc
gtaaactttggtgattccttttacctttctccgaaaagctcttcaaaatctgcgctcggt
tcgggagcaggaaacacgggagatttccttctattaaataatgcagtcaacgcgacaaat
tatatagaccccgatgtcaacgatcaggatatggttggaaacggataa

DBGET integrated database retrieval system