KEGG   Bacillus subtilis subsp. subtilis 168: BSU10680
Entry
BSU10680          CDS       T00010                                 

Symbol
gerPE
Name
(RefSeq) spore germination protein GerPE
  KO
K06303  spore germination protein PE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU10680 (gerPE)
SSDB
Motif
Pfam: GerPE GerPB gerPA
Other DBs
NCBI-GeneID: 939782
NCBI-ProteinID: NP_388949
Pasteur: BG13091
BSORF: BG13091
UniProt: O06717 A0A6M3ZCP0
Position
complement(1148744..1149145)
AA seq 133 aa
MLKRISRIRLVKFNSLGIASVFQVGDTNEIDMSVKVFAVQRSLSTFYHNEGSFNKKEYQI
FQQQAVKPLPETGVQSAFCHEVPAIYVRSIKIQGVSASSVLHAGSASLIRGDARLKHIRQ
IQSPRSQSPAKNI
NT seq 402 nt   +upstreamnt  +downstreamnt
atgcttaaacgcatatcgcgcatcagactagttaagtttaattctctcgggatcgcaagt
gtgtttcaagttggcgacacaaatgaaatcgatatgagtgtaaaagtatttgctgtgcag
cgttctctgtccacgttttaccataatgaaggctcatttaacaaaaaggagtatcagatc
tttcagcagcaggccgtgaagccgctccccgaaacaggtgtacaaagcgcgttttgccac
gaggtgccggctatttatgttcgcagcatcaaaattcaaggggtctcagcctcttctgtt
ttacatgccggatcagcttcgcttattcgcggtgatgcgagactcaaacatatcagacag
attcagtctccgcgctcacaatcgcccgccaagaacatataa

DBGET integrated database retrieval system