KEGG   Bacillus subtilis subsp. subtilis 168: BSU10690
Entry
BSU10690          CDS       T00010                                 

Symbol
gerPD
Name
(RefSeq) spore germination protein GerPD
  KO
K06302  spore germination protein PD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU10690 (gerPD)
SSDB
Motif
Pfam: GerPE GerPB gerPA
Other DBs
NCBI-GeneID: 936349
NCBI-ProteinID: NP_388950
Pasteur: BG13092
BSORF: BG13092
UniProt: O06718 A0A6M4JIG5
Position
complement(1149145..1149321)
AA seq 58 aa
MIFTVINRSLEVGDIRMNGVSSSSVFHIGDTESIYLSSIFDTPPESLIIGPFAPLAPE
NT seq 177 nt   +upstreamnt  +downstreamnt
atgatctttacagtcatcaaccgcagcttggaagtcggggatattcggatgaacggtgtg
tccagttcctccgttttccacatcggagacactgaatccatctacctgtcttctattttt
gatacaccgcctgaatctcttattattgggccgtttgctccgcttgcgccagaataa

DBGET integrated database retrieval system