KEGG   Bacillus subtilis subsp. subtilis 168: BSU10710Help
Entry
BSU10710          CDS       T00010                                 

Gene name
gerPB
Definition
(RefSeq) spore germination protein
  KO
K06300  spore germination protein PB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU10710 (gerPB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerPB GerPE
Motif
Other DBs
NCBI-GeneID: 939781
NCBI-ProteinID: NP_388952
Pasteur: BG13094
BSORF: BG13094
UniProt: O06720
Position
complement(1149958..1150200)
Genome map
AA seq 80 aa AA seqDB search
MRLMNFYINQTIQINYLRLESISNSSILQIGSAGSIKSLSNLYNTGSYVEPAPEVSGSGQ
PLQLQEPDTGSLVPLQPPGR
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctcatgaacttctatattaatcaaaccattcaaatcaactatctccggctggaa
tcaatcagcaactcctccattctgcaaatcgggagcgccggatcaatcaagtcactgtca
aatttgtataatacaggaagctatgtagagccggcaccagaagtttctggctcagggcaa
ccgctccagctgcaggagcccgacacaggttcattggtcccgctccagcctcctggccgt
taa

DBGET integrated database retrieval system