KEGG   Bacillus subtilis subsp. subtilis 168: BSU10720
Entry
BSU10720          CDS       T00010                                 

Symbol
gerPA
Name
(RefSeq) spore germination protein GerPA
  KO
K06299  spore germination protein PA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU10720 (gerPA)
SSDB
Motif
Pfam: gerPA GerPE HCBP_related
Other DBs
NCBI-GeneID: 936348
NCBI-ProteinID: NP_388953
Pasteur: BG13095
BSORF: BG13095
UniProt: O06721 A0A6M4JKA0
Position
complement(1150206..1150427)
AA seq 73 aa
MPAIVGAFKINAIGTSGVVHIGDCITISPQAQVRTFAGAGSFNTGDSLKVMNYQNATNVY
DNDAVDQPIVANA
NT seq 222 nt   +upstreamnt  +downstreamnt
atgccggccattgtcggagcgtttaaaattaatgcgattggtacgagcggagtcgttcac
atcggggactgcattacgatttctcctcaggctcaggtcagaacgtttgccggtgctggc
agctttaataccggcgacagcctcaaggtgatgaattatcaaaacgcgacgaatgtgtat
gacaatgatgcggttgatcagccgatcgtggccaatgcgtaa

DBGET integrated database retrieval system