KEGG   Bacillus subtilis subsp. subtilis 168: BSU10730
Entry
BSU10730          CDS       T00010                                 

Symbol
yisI
Name
(RefSeq) aspartyl-phosphate phosphatase YisI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SpoOE-like YrzK
Other DBs
NCBI-GeneID: 936347
NCBI-ProteinID: NP_388954
Pasteur: BG13096
BSORF: BG13096
UniProt: O06722 A0A6M3Z9G2
Position
complement(1150850..1151020)
AA seq 56 aa
MNSKIEEMRITLIETAQKYGMNSKETIQCSQELDILLNTRIKEEMIFGRYLENSRM
NT seq 171 nt   +upstreamnt  +downstreamnt
atgaacagtaaaattgaagaaatgaggatcacactaattgaaaccgcacaaaaatacggc
atgaattcaaaagaaacgattcaatgcagccaagagctggatatcctgctgaatacccgg
attaaagaagaaatgatttttgggagatatcttgaaaactcccgtatgtaa

DBGET integrated database retrieval system