KEGG   Bacillus subtilis subsp. subtilis 168: BSU10740
Entry
BSU10740          CDS       T00010                                 

Symbol
yisJ
Name
(RefSeq) inner spore coat protein H-like protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CotH
Other DBs
NCBI-GeneID: 939786
NCBI-ProteinID: NP_388955
Pasteur: BG13097
BSORF: BG13097
UniProt: O06723 A0A6M4JEU9
Position
complement(1151166..1152089)
AA seq 307 aa
MERVHLFFHREQLKRKGTAKGLFVTDRSVSPILLTQRDRAEKASYEISWEKSLLGERTLF
LNAEQDDPSLMRRRLAYCFFDQIGVPAPVASYSFLTINGQPEGIYLNIKNHQPAGKRSYG
VKTADPRVPLSLFNNDSSAFLHEFFILIRTAGDDELAERIKLYLDVKLFFLWLIGNTCTN
QGFYYTFCLNESGRLYVSPMETRSLAVQEWYEEDPLLTKGKTLSSRLLSIPAFRSQYHTL
MKNVLKRSFTIERLSPLINEWHLDICQSAADDPFIKKSPFQIEKEQTNILREIEERQDFL
QAHLARL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggagcgcgtgcatttattttttcatcgggagcagctgaaaaggaaaggtacagccaag
gggcttttcgtaacagatcgatctgtttctcccattcttctcacacagcgtgacagagcg
gaaaaggcatcctatgaaatcagctgggaaaagtctctgcttggtgaaaggacacttttt
ttgaatgcagaacaggatgatccgtccctgatgcggcgcagactcgcctattgttttttt
gaccagatcggcgtacctgctcccgttgcctcgtacagctttctgaccatcaatggccag
cctgaaggcatttatttgaacatcaagaaccatcagccagccggtaaaaggagttacgga
gtgaagacggccgatccaagggttccattgtccctttttaacaatgattcctcggcattc
ttacatgaatttttcatactgatccgcacagccggagatgacgaattggctgaaaggatt
aaattgtatctggatgtcaagctgttttttttgtggctgatcggcaacacctgcaccaat
caaggcttttactacacattttgtttaaacgaatccggtcggctttacgtttccccgatg
gagacaagatcgcttgccgtacaagaatggtatgaagaagacccgcttctgacaaaagga
aagacgctttcgtcaaggcttctatccattcccgccttcaggtcgcaatatcacacctta
atgaaaaacgtgctgaagcggtcgtttactattgaacgattatctcctctcatcaacgaa
tggcaccttgacatttgtcaaagtgctgctgatgatccttttatcaaaaaaagccccttt
caaatcgaaaaggagcagaccaacatacttagagaaattgaggaacggcaggactttttg
caagcacacttagcaagactttag

DBGET integrated database retrieval system