KEGG   Bacillus subtilis subsp. subtilis 168: BSU10750
Entry
BSU10750          CDS       T00010                                 

Symbol
yisK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-GeneID: 936356
NCBI-ProteinID: NP_388956
Pasteur: BG13098
BSORF: BG13098
UniProt: O06724 A0A6M4JGU3
Position
1152244..1153149
AA seq 301 aa
MKFATGELYNRMFVGLIIDDEKIMDLQKAEKKLFELETIPGSLIECIAEGDKFVAHARQL
AEWAKKPNDELGSFMYSLSEVKLHAPIPKPSKNIICIGKNYRDHAIEMGSEADIPEHPMV
FTKSPVTVTGHGDIVKSHEEVTSQLDYEGELAVVIGKSGTRISKEDAYDHVFGYTIVNDI
TARDLQKRHKQFFIGKSLDTTCPMGPVLVHKSSIQEPERLKVETRVNGELRQSGSASDMI
FSIPELIETLSKGMTLEAGDIIATGTPSGVGKGFTPPKFLRSGDKIDITIDPIGTLSNQI
G
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaaatttgcgacaggggaactttacaaccgaatgtttgtcggcctgatcattgacgat
gagaaaattatggatttgcagaaggctgaaaaaaaactgtttgaacttgagacgattccg
ggatcgctgattgaatgtatcgcagaaggggataaattcgttgcgcatgcaaggcagctg
gccgagtgggcaaagaaaccgaatgatgagctgggatcatttatgtattcattatctgag
gtgaagctccatgcacccattccgaagccatcaaaaaatatcatctgcatcggcaaaaac
taccgggatcacgcgattgaaatggggagcgaggctgatattccggagcatccgatggta
tttacaaaatcgccggtaacggttacggggcatggtgatatcgtaaagagccatgaagag
gttacctctcagcttgattatgagggagaacttgctgtcgtgatcggaaaaagcgggact
cgcatttcaaaagaagatgcatatgaccatgttttcggatatacgattgtgaatgatatc
acggcgcgtgatctgcaaaaaaggcataagcagttttttatcggaaaaagcttggatacg
acatgtccgatggggcccgtgcttgtacataaatcatctattcaggagccagagcgcctc
aaggttgaaacaagagtcaacggcgagctgcgccaatccggttcggcaagcgatatgatc
ttttccattccggaattaattgaaaccctctcaaaggggatgacgcttgaagcgggcgac
attattgccaccggtacgccgtctggtgtcggcaaggggtttacgcctccaaaattcttg
cggtcaggtgacaaaattgatattacaattgatccgatcggaacgctgtcaaaccaaatt
ggctga

DBGET integrated database retrieval system