KEGG   Bacillus subtilis subsp. subtilis 168: BSU10760
Entry
BSU10760          CDS       T00010                                 

Symbol
yisL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1516 SirB DUF975 DUF2206 DUF3953 DUF2231
Other DBs
NCBI-GeneID: 939333
NCBI-ProteinID: NP_388957
Pasteur: BG13099
BSORF: BG13099
UniProt: O06725 A0A6M3Z977
Position
1153265..1153621
AA seq 118 aa
MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWN
GEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF
NT seq 357 nt   +upstreamnt  +downstreamnt
atgacacacctacatattacgacatgggtggtagcgctgattctgcttttcgtcagctac
tcgctgtattcgtcaggaagtgcaaagggcgcaaaaatcactcatatgattctgcggtta
ttctatatccttattattttgacaggagctgagctgtttgtccgtttcgccaactggaac
ggagaatacgccggcaaaatgattctgggcattatcaccatcggcctgatggaaatgctc
ctcatccgcaagaaaaaagaaaaatcaacaggaggcctgtgggtcggcttcgtcattgtc
cttttgctgacagtgctgctcggtctgcatttgccaattggttttcaattgttttaa

DBGET integrated database retrieval system