KEGG   Bacillus subtilis subsp. subtilis 168: BSU10780
Entry
BSU10780          CDS       T00010                                 

Symbol
yisN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2777 DUF5075
Other DBs
NCBI-GeneID: 936354
NCBI-ProteinID: NP_388959
Pasteur: BG12239
BSORF: BG12239
UniProt: O06727 A0A6M4JGR1
Position
complement(1156504..1157091)
AA seq 195 aa
MKKKETAWMKRKQLLYTEERKWEYGTILIEDGICLIENGEGDILLADSLQHSPIWIHHKG
KWEQAGFQDKLVLACGAENISLSGGERIRYEKSVKRPLMALLDSLDDETFLAFLQHLHSF
GLSVFDCVFSYNKGVFSNTSAGQGVSFYHFSNDTAQCAMQHHYNYSSEGTGDRFEWTASN
GKRSIMYTAVQRGRK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagaaaaaggagacagcatggatgaaacggaaacaattgttatatacagaggaacga
aagtgggaatacggcaccatcctcattgaagacggcatctgcttaatcgaaaacggtgaa
ggcgatatactgctggcggacagtctccaacacagcccaatctggatccatcataaagga
aagtgggagcaagccggctttcaggacaagttggttttggcatgcggtgcagaaaacatc
tccctttccggcggagaacgcatccgctatgagaaatcagtcaagcggccgctcatggcg
cttttggattcgcttgacgacgaaacctttctcgcatttctgcagcacttgcacagcttc
ggcttatcggtattcgattgcgtcttttcttataataaaggagtcttttcgaatacttcg
gcggggcagggtgtgtccttttatcacttttcaaatgacaccgcacaatgcgcgatgcag
catcactacaactacagcagcgaagggacaggagaccgttttgaatggacggcttcaaac
ggaaagcgatccattatgtacacagcagtccaacgggggcgcaaataa

DBGET integrated database retrieval system