KEGG   Bacillus subtilis subsp. subtilis 168: BSU10790
Entry
BSU10790          CDS       T00010                                 

Symbol
asnO
Name
(RefSeq) asparagine synthetase 3
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU10790 (asnO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU10790 (asnO)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BSU10790 (asnO)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C44
   BSU10790 (asnO)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Other DBs
NCBI-GeneID: 939783
NCBI-ProteinID: NP_388960
Pasteur: BG12240
BSORF: BG12240
UniProt: O05272 A0A6M4JIH4
Position
1157237..1159081
AA seq 614 aa
MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEGGR
QPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVDH
LNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDRT
GLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNIWRYWNVESEKHTDSFDDTVA
NVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSIDYEEND
KYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRSTEERIKLLSDSWQKK
LNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYPKTHHPEY
TKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLLETEGSSFKVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIDER
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgtgtggaattacgggttgggtcgattttaaaaagcagctcgtccaggaaaaacaaacg
atggacagaatgacagacactctttccaaacgagggcctgatgattcaaacgtttggggg
gagcaccatgttttattcggacataaaagacttgcggttgttgatattgaaggcggacgc
cagccgatggcgtgtacctataaaggcgatacgtacaccattatttacaatggcgagctt
tataacacggaagatttgcgcaaagaattgcgggcgcggggccatcaattcgagcgtacg
tcagataccgaggtgcttctgcacagctacatcgagtggcaggaagactgtgtcgaccat
ctcaatggcatattcgctttcgctgtgtgggatgaaaagcgtaatctgttgtttgccgcg
agagaccgtctcggtgtaaagccgtttttttacacgaaggaaggctcttcatttctcttc
gggtcggaaatcaaagcaatcctcgcgcaccctgatataaaagcgcgagtggacagaacg
ggactttctgaaattttcggtcttggaccgtccagaaccccgggcactggcatatttaaa
ggcataaaagaaatccgcccggctcacgcgctgacattttccaaagacggacttaatatt
tggcgttattggaatgttgaaagcgaaaaacatacggacagttttgatgacacggttgcc
aatgtcagatcgttatttcaggacgcggtgacgcggcagcttgtgtcggatgtgcctgtt
tgcacattcctatcaggcggtctggactcaagcgcgattacagcgattgcggcgggccat
tttgaaaaggaaggaaaagcaccgcttcatacttattcgattgattacgaagagaacgat
aaatattttcaagcaagcgcttttcagccgaatgatgacggaccatggattgaaaaaatg
acagaggctttcggcacaacgcaccacaaatgcgtcatcagccaaaaagacctcgttgat
catttggaggaagctgtactggtcaaagacttgccgggaatggcagatgtcgactcatcc
ctgctgtggttttgccgggaaatcaaaaaggactttgtcgtcagcctatcgggagaatgc
gcggatgagattttcggcgggtacccgtggttccatacggcagatgttgagtctggcttt
ccatggatgagatcaacggaggagcggatcaagctgctttctgactcatggcagaaaaaa
ttgaatctgaaagaatacgtaaatgccaaatatgaagaaaccttggcagaaacgccatta
ttagacggagaaacgggtgtggataaagcaagaagacagctgttctatttaaatatgctt
tggtttatgacgaaccttttggatcggaaggatcgcatgagcatgggggcgagcctggaa
gtgcgggtgccgttcgccgatcaccggcttgtggaatatgtttggaatattccgtgggaa
atgaaaatgcatgataatcgggaaaaaggcattttgcgcaaagcgcttgagggcattttg
cctgatgacattttgtatcgcaaaaaaagcccatatccgaaaacacatcatccggaatat
acaaaaggcgtcagcgagtggctgaaaacgatcagaagccaaaaggactccgtgctccat
accttactggacagaaaacaattagatcagcttttagaaacggaaggctcctccttcaag
gtcccgtggttcgggcagctcatgaaggggcctcagctgatcgcccatcttgctcaaatt
catacatggtttgaagcgtatcgcattgatattgacgagaggtag

DBGET integrated database retrieval system